Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: neima-metx

Neisseria meningitidis (serogroup ABC), Neisseria gonorrhoeae, Neisseria lactamica, Neisseria polysaccharea, Neisseria cinerea, Neisseria mucosa (homoserine transacetylase) (hta)

Comment
Other strains: Neisseria meningitidis (alpha275; ATCC 13091; ES14902; M0579; M13399; 961-5945; M6190; M01-240013; alpha14; alpha153; OX99.30304; CU385; N1568; serogroups: A (WUE 2594; NZ-05/33) B (M04-240196; G2136; serotype 15 H44/76; M01-240355; alpha710; M01-240149) C (serotype 2a ATCC 700532; 8013; 053442)), Neisseria gonorrhoeae (ATCC 700825 / FA 1090; SK-92-679; MS11; DGI2; 35/02; FA19; PID1; NCCP11945; F62; TCDC-NG08107; SK-93-1035; PID332; PID18; 1291), Neisseria lactamica (Y92-1009; 020-06; ATCC 23970), Neisseria polysaccharea ATCC 43768, Neisseria sicca ATCC 29256, Neisseria cinerea ATCC 14685, Neisseria mucosa ATCC 25996


Relationship
Family|Homoserine_transacetylase
Block| X
Position in NCBI Life Tree|Neisseria meningitidis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Neisseriales: N E > Neisseriaceae: N E > Neisseria: N E > Neisseria meningitidis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: AL162755, AM421808, AE002445
>3 UniProt links 17 more: Q9JUT9, A1KTK9, Q9JZQ5
>3 UniProt links 17 more: Q9JUT9, A1KTK9, Q9JZQ5
>3 Interpro links 17 more: Q9JUT9, A1KTK9, Q9JZQ5
>3 Prodom links 17 more: Q9JUT9, A1KTK9, Q9JZQ5
>3 Pfam links 17 more: Q9JUT9, A1KTK9, Q9JZQ5
>3 PIRSF links 17 more: Q9JUT9, A1KTK9, Q9JZQ5
>3 SUPERFAM links 17 more: Q9JUT9, A1KTK9, Q9JZQ5
Sequence
Graphical view for this peptide sequence: neima-metx
Colored MSA for Homoserine_transacetylase (raw)
MSQNASVGIVTPQKIPFEMPLVLENGKTLPRFDLMIETYGELNAEKNNAV
LICHALSGNHHVAGRHSAEDKYTGWWDNMVGPGKPIDTERFFVVGLNNLG
GCDGSSGPLSINPETGREYGADFPVVTVKDWVKSQAALTDYLGIGQWAAV
VGGSLGGMQALQWTISYPERVRHALVIASAPKLSTQNIAFNDVARQAILT
DPDFNEGHYRSRNTVPARGLRIARMMGHITYLAEDGLGKKFGRDLRSNGY
QYGYGVEFEVESYLRYQGDKFVGRFDANTYLLMTKALDYFDPAADFGNSL
TRAVQDVQAKFFVASFSTDWRFAPERSHELVKALIAAQKSVQYIEVKSAH
GHDAFLMEDEAYMRAVAAYMNNVYKECQQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSQNASVGIVTPQKIPFEMPLVLENGKTLPRFDLMIETYGELNAEKNNAV
LICHALSGNHHVAGRHSAEDKYTGWWDNMVGPGKPIDTERFFVVGLNNLG
GCDGSSGPLSINPETGREYGADFPVVTVKDWVKSQAALTDYLGIGQWAAV
VGGSLGGMQALQWTISYPERVRHALVIASAPKLSTQNIAFNDVARQAILT
DPDFNEGHYRSRNTVPARGLRIARMMGHITYLAEDGLGKKFGRDLRSNGY
QYGYGVEFEVESYLRYQGDKFVGRFDANTYLLMTKALDYFDPAADFGNSL
TRAVQDVQAKFFVASFSTDWRFAPERSHELVKALIAAQKSVQYIEVKSAH
GHDAFLMEDEAYMRAVAAYMNNVYKECQQ


References
10 more
    Title: Meningococcal genetic variation mechanisms viewed through comparative analysis of serogroup C strain FAM18
    Bentley SD, Vernikos GS, Snyder LA, Churcher C, Arrowsmith C, Chillingworth T, Cronin A, Davis PH, Holroyd NE and Parkhill J <11 more author(s)>
    Ref: PLoS Genet, 3:e23, 2007 : PubMed

            

    Title: Complete DNA sequence of a serogroup A strain of Neisseria meningitidis Z2491
    Parkhill J, Achtman M, James KD, Bentley SD, Churcher C, Klee SR, Morelli G, Basham D, Brown D and Barrell BG <18 more author(s)>
    Ref: Nature, 404:502, 2000 : PubMed

            

    Title: Complete genome sequence of Neisseria meningitidis serogroup B strain MC58
    Tettelin H, Saunders NJ, Heidelberg J, Jeffries AC, Nelson KE, Eisen JA, Ketchum KA, Hood DW, Peden JF and Venter JC <32 more author(s)>
    Ref: Science, 287:1809, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer