Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: orysa-Q0JK71

Oryza sativa (japonica cultivar-group) subsp. indica (Rice); Oryza barthii; Oryza glumipatula; Oryza nivara (Indian wild rice) (Oryza sativa f. spontanea); Oryza glaberrima (African rice); Oryza rufipogon (Brownbeard rice) (Asian wild rice) similar to arabidopsis thaliana chromosome 1, at1g15060

Comment
obsolete Q8RZY4 P0034C09.28 Other strains: Oryza sativa (japonica cultivar-group) subsp. indica (Rice); Oryza barthii; Oryza glumipatula; Oryza nivara (Indian wild rice) (Oryza sativa f. spontanea); Oryza glaberrima (African rice); Oryza rufipogon (Brownbeard rice) (Asian wild rice)


Relationship
Family|UCP031088
Block| X
Position in NCBI Life Tree|Oryza sativa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Oryzoideae: N E > Oryzeae: N E > Oryzinae: N E > Oryza: N E > Oryza sativa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: orysa-Q0JK71
Colored MSA for UCP031088 (raw)
MPLLHAANLRVLLAGAAFAHLSSPAATARASSPSAPPPPAPPPPPRVRAF
ASYRASPPPPPPPQPSSPSPSRALASAAAACEQGAKPAICTADELHYVPV
PGTEWRLALWRYRPPPEAPKRNHPLMLLSGVATNAIGFDLSPGASFARHM
SMQGFDTWIVEVRGAGLSMRGSELAVADTTSDMSRSSALDEITTQKLNGA
GPAKDDSTCLAQNFEVPVVEDKFEVPVVEDKDVIESNALEEPQLVTKLSN
TLARLGDTFSGYVKDSRLRSIADGFFNQVSELVPDASLTSSLEEVSEKIL
GLLELPQTSAISDQISHLSLRLVNILGEGQQNISPRLFGWQERLSATIED
LQKQLELIISYDWDFDHYLEEDVPAAMNYIKQQSPTKDGKLLAIGHSMGG
ILLYAMVSKCGCEGAEPELVAIVTLASSVDYTTSNSSLKLLLPLADPAEM
LRVPAIPVGTLLSTTYPISSRAPYILSLLRSQISSKDMMDPDLLSKLVLN
NFCTVPAKVLLQLTTAFRDGGLRNRAGTFFFKQHLHKIKVPILALAGDED
LICPPEAVYETVKLIPQHLVTYKVFGKPEGPHYAHYDLVGGRKAVHEVYP
CIIEFLSQHDEVSS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPLLHAANLRVLLAGAAFAHLSSPAATARASSPSAPPPPAPPPPPRVRAF
ASYRASPPPPPPPQPSSPSPSRALASAAAACEQGAKPAICTADELHYVPV
PGTEWRLALWRYRPPPEAPKRNHPLMLLSGVATNAIGFDLSPGASFARHM
SMQGFDTWIVEVRGAGLSMRGSELAVADTTSDMSRSSALDEITTQKLNGA
GPAKDDSTCLAQNFEVPVVEDKFEVPVVEDKDVIESNALEEPQLVTKLSN
TLARLGDTFSGYVKDSRLRSIADGFFNQVSELVPDASLTSSLEEVSEKIL
GLLELPQTSAISDQISHLSLRLVNILGEGQQNISPRLFGWQERLSATIED
LQKQLELIISYDWDFDHYLEEDVPAAMNYIKQQSPTKDGKLLAIGHSMGG
ILLYAMVSKCGCEGAEPELVAIVTLASSVDYTTSNSSLKLLLPLADPAEM
LRVPAIPVGTLLSTTYPISSRAPYILSLLRSQISSKDMMDPDLLSKLVLN
NFCTVPAKVLLQLTTAFRDGGLRNRAGTFFFKQHLHKIKVPILALAGDED
LICPPEAVYETVKLIPQHLVTYKVFGKPEGPHYAHYDLVGGRKAVHEVYP
CIIEFLSQHDEVSS


References
7 more
    Title: De Novo Next Generation Sequencing of Plant Genomes
    Rounsley S, Marri PR, Yu Y, He R, Sisneros N, Goicoechea JL, Lee SJ, Angelova A, Kudrna D and Wing RA <6 more author(s)>
    Ref: Rice, 2:35, 2009 : PubMed

            

    Title: The map-based sequence of the rice genome.
    Matsumo T, Sasaki T
    Ref: Nature, 436:793, 2005 : PubMed

            

    Title: The genome sequence and structure of rice chromosome 1
    Sasaki T, Matsumoto T, Yamamoto K, Sakata K, Baba T, Katayose Y, Wu J, Niimura Y, Cheng Z and Gojobori T <69 more author(s)>
    Ref: Nature, 420:312, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer