Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-AT4G24380

Arabidopsis thaliana (Mouse-ear cress); Eutrema halophilum (Salt cress); Eutrema salsugineum (Saltwater cress) (Sisymbrium halophilum hypothetical protein; Capsella rubella

Comment
Other strains: Arabidopsis thaliana (Mouse-ear cress); Eutrema halophilum (Salt cress); Eutrema salsugineum (Saltwater cress) (Sisymbrium halophilum, Sisymbrium salsugineum); Capsella rubella


Relationship
Family|FSH1
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: arath-AT4G24380
Colored MSA for FSH1 (raw)
MGSEGRSIARKPRFLCLHGFRTSGEIMKIQLHKWPKSVIDRLDLVFLDAP
FPCQGKSDVEGIFDPPYYEWFQFNKEFTEYTNFEKCLEYLEDRMIKLGPF
DGLIGFSQGAILSGGLPGLQAKGIAFQKVPKIKFVIIIGGAKLKSAKLAE
NAYSSSLETLSLHFLGETDFLKPYGTQLIESYKNPVVVHHPKGHTVPRLD
EKSLEKVTAFIDTLEHLVMEEDKNGEENTSKPTK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGSEGRSIARKPRFLCLHGFRTSGEIMKIQLHKWPKSVIDRLDLVFLDAP
FPCQGKSDVEGIFDPPYYEWFQFNKEFTEYTNFEKCLEYLEDRMIKLGPF
DGLIGFSQGAILSGGLPGLQAKGIAFQKVPKIKFVIIIGGAKLKSAKLAE
NAYSSSLETLSLHFLGETDFLKPYGTQLIESYKNPVVVHHPKGHTVPRLD
EKSLEKVTAFIDTLEHLVMEEDKNGEENTSKPTK


References
    Title: Full-length messenger RNA sequences greatly improve genome annotation
    Haas BJ, Volfovsky N, Town CD, Troukhan M, Alexandrov N, Feldmann KA, Flavell RB, White O, Salzberg SL
    Ref: Genome Biol, 3:RESEARCH0029, 2002 : PubMed

            

    Title: Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana
    Mayer K, Schuller C, Wambutt R, Murphy G, Volckaert G, Pohl T, Dusterhoft A, Stiekema W, Entian KD and McCombie WR <220 more author(s)>
    Ref: Nature, 402:769, 1999 : PubMed

            

    Title: Analysis of 1.9 Mb of contiguous sequence from chromosome 4 of Arabidopsis thaliana.
    Bevan M, Bancroft I, Bent E, Love K, Goodman H, Dean C, Bergkamp R, Dirkse W, van Staveren M and Chalwatzis N <58 more author(s)>
    Ref: Nature, 391:485, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer