Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-PAD4

Arabidopsis thaliana (Mouse-ear cress) PAD4 lipase 61.0 kda protein EDS9 At3g52430 AtPAD4

Comment
The Arabidopsis EDS1 (arath-eds1) and PAD4 (arath-PAD4) genes encode lipase-like proteins that function in resistance (R) gene-mediated and basal plant disease resistance.EDS1 can dimerize and interact with PAD4 and SAG101 (arath-At5g14930) Plants utilise intracellular nucleotide-binding, leucine-rich repeat (NLR) immune receptors to detect pathogen effectors and activate local and systemic defence. NRG1 and ADR1 'helper' NLRs (RNLs) cooperate with enhanced disease susceptibility 1 (EDS1), senescence-associated gene 101 (SAG101) and phytoalexin-deficient 4 (PAD4) lipase-like proteins to mediate signalling from TIR domain NLR receptors (TNLs). Two distinct modules (NRG1/EDS1/SAG101 and ADR1/EDS1/PAD4) mediate TNL receptor defence signalling.


Relationship
Family|Plant_lipase_EDS1-like
Block| L
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
2 structures: 7XDD, 7XEY
No kinetic





3 substrates: ADP-ribose, pRib-ADP, pRib-AMP
No inhibitor
2 Genbank : AL050300, AF188329
>3 UniProt links 5 more: Q9S745, B2BDL2, B2BDL6
2 Structure : 7XDD, 7XEY
>3 UniProt links 5 more: Q9S745, B2BDL2, B2BDL6
>3 Interpro links 5 more: Q9S745, B2BDL2, B2BDL6
>3 Prodom links 5 more: Q9S745, B2BDL2, B2BDL6
>3 Pfam links 5 more: Q9S745, B2BDL2, B2BDL6
>3 PIRSF links 5 more: Q9S745, B2BDL2, B2BDL6
>3 SUPERFAM links 5 more: Q9S745, B2BDL2, B2BDL6
1 Tair database : At3g52430
Sequence
Graphical view for this peptide sequence: arath-PAD4
Colored MSA for Plant_lipase_EDS1-like (raw)
MDDCRFETSELQASVMISTPLFTDSWSSCNTANCNGSIKIHDIAGITYVA
IPAVSMIQLGNLVGLPVTGDVLFPGLSSDEPLPMVDAAILKLFLQLKIKE
GLELELLGKKLVVITGHSTGGALAAFTALWLLSQSSPPSFRVFCITFGSP
LLGNQSLSTSISRSRLAHNFCHVVSIHDLVPRSSNEQFWPFGTYLFCSDK
GGVCLDNAGSVRLMFNILNTTATQNTEEHQRYGHYVFTLSHMFLKSRSFL
GGSIPDNSYQAGVALAVEALGFSNDDTSGVLVKECIETATRIVRAPILRS
AELANELASVLPARLEIQWYKDRCDASEEQLGYYDFFKRYSLKRDFKVNM
SRIRLAKFWDTVIKMVETNELPFDFHLGKKWIYASQFYQLLAEPLDIANF
YKNRDIKTGGHYLEGNRPKRYEVIDKWQKGVKVPEECVRSRYASTTQDTC
FWAKLEQAKEWLDEARKESSDPQRRSLLREKIVPFESYANTLVTKKEVSL
DVKAKNSSYSVWEANLKEFKCKMGYENEIEMVVDESDAMET
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDDCRFETSELQASVMISTPLFTDSWSSCNTANCNGSIKIHDIAGITYVA
IPAVSMIQLGNLVGLPVTGDVLFPGLSSDEPLPMVDAAILKLFLQLKIKE
GLELELLGKKLVVITGHSTGGALAAFTALWLLSQSSPPSFRVFCITFGSP
LLGNQSLSTSISRSRLAHNFCHVVSIHDLVPRSSNEQFWPFGTYLFCSDK
GGVCLDNAGSVRLMFNILNTTATQNTEEHQRYGHYVFTLSHMFLKSRSFL
GGSIPDNSYQAGVALAVEALGFSNDDTSGVLVKECIETATRIVRAPILRS
AELANELASVLPARLEIQWYKDRCDASEEQLGYYDFFKRYSLKRDFKVNM
SRIRLAKFWDTVIKMVETNELPFDFHLGKKWIYASQFYQLLAEPLDIANF
YKNRDIKTGGHYLEGNRPKRYEVIDKWQKGVKVPEECVRSRYASTTQDTC
FWAKLEQAKEWLDEARKESSDPQRRSLLREKIVPFESYANTLVTKKEVSL
DVKAKNSSYSVWEANLKEFKCKMGYENEIEMVVDESDAMET


References
10 more
    Title: Cavity surface residues of PAD4 and SAG101 contribute to EDS1 dimer signaling specificity in plant immunity
    Dongus JA, Bhandari DD, Penner E, Lapin D, Stolze SC, Harzen A, Patel M, Archer L, Dijkgraaf L and Parker JE <2 more author(s)>
    Ref: Plant J, :, 2022 : PubMed

            

    Title: Identification and receptor mechanism of TIR-catalyzed small molecules in plant immunity
    Huang S, Jia A, Song W, Hessler G, Meng Y, Sun Y, Xu L, Laessle H, Jirschitzka J and Chai J <10 more author(s)>
    Ref: Science, :, 2022 : PubMed

            

    Title: PopP2 interacts with PAD4 in an acetyltransferase activity-dependent manner and affects plant immunity
    Huh SU
    Ref: Plant Signal Behav, :2017631, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer