Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-SCP15

Arabidopsis thaliana (Mouse-ear cress) SCPL15 At3g12240 F28J15.13 carboxypeptidase

Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AC069472, AP002047
1 UniProt : Q9C7D2
1 Ncbi-nid : 8134871
1 Ncbi-pid : 12322053
1 UniProt : Q9C7D2
1 Interpro : Q9C7D2
1 Prodom : Q9C7D2
1 Pfam : Q9C7D2
1 PIRSF : Q9C7D2
1 SUPERFAM : Q9C7D2
1 Tair database : At3g12240
Sequence
Graphical view for this peptide sequence: arath-SCP15
Colored MSA for Carboxypeptidase_S10 (raw)
MASWIFKLLLLLQCVLVLIQHADSSSIIRYLPGFEGPLPFELETGYIGVG
QKEEDQLFYYFIKSENNPEEDPLLVWLTGGPGCSSFSGLVYENGPLAFKV
ETYNGSVPTLVSTTYSWTKVANIIYLDQPVGTGFSYSRNPFADIPSDTGS
VKRVNEFVRKWLAKHPEYFSNPFYVTGNSYSGKVIPAIVQEISNGNYICC
KPQINLQGYVIGNPVAYYDHDKDFRIPFAHGVALISDELFESLKASCGGS
YSVVDPLNTECLKLIEDYDKCVSGIYEELILKSKCEHTSPDCYTYRYLLS
EYWADNETVRRALKVVKGSKGTWERCDYRVLSNQDIKSSIPFHINNSIRG
YRSLVISGDHDMTIPFLGTQAWIRSLNYSITEKWRPWMILDQVAGYTKTY
ANKMTLATVKVCSFIHIYMSNKNAKLVYTSLLIGLWVWFIIGRWAHIGI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASWIFKLLLLLQCVLVLIQHADSSSIIRYLPGFEGPLPFELETGYIGVG
QKEEDQLFYYFIKSENNPEEDPLLVWLTGGPGCSSFSGLVYENGPLAFKV
ETYNGSVPTLVSTTYSWTKVANIIYLDQPVGTGFSYSRNPFADIPSDTGS
VKRVNEFVRKWLAKHPEYFSNPFYVTGNSYSGKVIPAIVQEISNGNYICC
KPQINLQGYVIGNPVAYYDHDKDFRIPFAHGVALISDELFESLKASCGGS
YSVVDPLNTECLKLIEDYDKCVSGIYEELILKSKCEHTSPDCYTYRYLLS
EYWADNETVRRALKVVKGSKGTWERCDYRVLSNQDIKSSIPFHINNSIRG
YRSLVISGDHDMTIPFLGTQAWIRSLNYSITEKWRPWMILDQVAGYTKTY
ANKMTLATVKVCSFIHIYMSNKNAKLVYTSLLIGLWVWFIIGRWAHIGI


References
    Title: An expression and bioinformatics analysis of the Arabidopsis serine carboxypeptidase-like gene family
    Fraser CM, Rider LW, Chapple C
    Ref: Plant Physiol, 138:1136, 2005 : PubMed

            

    Title: Structural analysis of Arabidopsis thaliana chromosome 3. II. Sequence features of the 4,251,695 bp regions covered by 90 P1, TAC and BAC clones
    Kaneko T, Katoh T, Sato S, Nakamura A, Asamizu E, Tabata S
    Ref: DNA Research, 7:217, 2000 : PubMed

            

    Title: Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana
    Salanoubat M, Lemcke K, Rieger M, Ansorge W, Unseld M, Fartmann B, Valle G, Blocker H, Perez-Alonso M and Tabata S <127 more author(s)>
    Ref: Nature, 408:820, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer