bacsu-YVAK

 
Bacillus subtilis, Bacillus amyloliquefaciens, Bacillus atrophaeus, Bacillus subtilis, YvaK protein Carboxylesterase

Comment
Other strains: Bacillus subtilis ( and subsp. natto BEST195 subsp. spizizenii (ATCC 6633; ATCC 23059 / NRRL B-1447 / W23; TU-B-10); subsp. inaquosorum (KCTC 13429); BSn5; BEST7613; B4067 NODE_30; SC-8; XF-1) Bacillus amyloliquefaciens (strains FZB42; ATCC 23350 / DSM 7 / NBRC 15535 / NRRL B-14393; TA208; LL3; Y2; subsp. amyloliquefaciens KHG19; subsp. plantarum UCMB5033) Bacillus atrophaeus (1942; UCMB-5137) Bacillus sp. (BT1B_CT2; BH072; 5B6; subsp. niger; JS; EGD-AK10; YP1), Bacillus subtilis BEST7613


Relationship
Block X
Bacillus subtilis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 33 more: Z99121, CP000560, AP011541
>3 UniProt links 9 more: O32232, A7Z8U6, D4G1I8
>3 UniProtTrembl links 9 more: O32232, A7Z8U6, D4G1I8
>3 Interpro links 9 more: O32232, A7Z8U6, D4G1I8
>3 Prodom links 9 more: O32232, A7Z8U6, D4G1I8
>3 Pfam links 9 more: O32232, A7Z8U6, D4G1I8
>3 PIRSF links 9 more: O32232, A7Z8U6, D4G1I8
>3 SUPERFAM links 9 more: O32232, A7Z8U6, D4G1I8
>3 QuickSwissBlast links 9 more: O32232, A7Z8U6, D4G1I8
 
Sequence
Graphical view for this peptide sequence: bacsu-YVAK
Colored MSA for CarbLipBact_1 (raw)
MSMKVVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAP
QYEGHGVPPEELVHTGPEDWWKNVMDGYEYLKSEGYESIAACGLSLGGVF
SLKLGYTVPIKGIVPMCAPMHIKSEEVMYQGVLSYARNYKKFEGKSPEQI
EEEMKEFEKTPMNTLKALQDLIADVRNNVDMIYSPTFVVQARHDHMINTE
SANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEFLEKLDW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSMKVVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAP
QYEGHGVPPEELVHTGPEDWWKNVMDGYEYLKSEGYESIAACGLSLGGVF
SLKLGYTVPIKGIVPMCAPMHIKSEEVMYQGVLSYARNYKKFEGKSPEQI
EEEMKEFEKTPMNTLKALQDLIADVRNNVDMIYSPTFVVQARHDHMINTE
SANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEFLEKLDW

no DNA




References
12 more
    Title: Whole genome assembly of a natto production strain Bacillus subtilis natto from very short read data
    Nishito Y, Osana Y, Hachiya T, Popendorf K, Toyoda A, Fujiyama A, Itaya M, Sakakibara Y
    Ref: BMC Genomics, 11:243, 2010 : PubMed

            

    Title: Comparative analysis of the complete genome sequence of the plant growth-promoting bacterium Bacillus amyloliquefaciens FZB42
    Chen XH, Koumoutsi A, Scholz R, Eisenreich A, Schneider K, Heinemeyer I, Morgenstern B, Voss B, Hess WR and Borriss R <9 more author(s)>
    Ref: Nat Biotechnol, 25:1007, 2007 : PubMed

            

    Title: The complete genome sequence of the gram-positive bacterium Bacillus subtilis
    Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A and Danchin A <140 more author(s)>
    Ref: Nature, 390:249, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer