Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ecoli-IROE

Escherichia coli, Enterobactin and Salmochelin Hydrolase IroE, Salmochelin siderophore protein

Comment
The proliferation of many pathogenic bacteria is limited by the scarcity of soluble iron in their environment. Many of these bacteria scavenge iron by synthesizing and exporting small molecule siderophores that chelate iron. Iron-bound siderophores are subsequently imported for metabolic processing. Three related serine hydrolases have been characterized biochemically in this pathway: Fes, IroD, and IroE. There are more than 200 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Escherichia coli
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Escherichia: N E > Escherichia coli: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 2GZR, 2GZS
No kinetic





No Substrate
1 inhbitor:
DFP
Sequence
Graphical view for this peptide sequence: ecoli-IROE
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MYAREYRSTRPHKAIFFHLSCLTLICSAQVYAEPDMRPLGPNIADKGSVF
YHFSTTSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDD
ELLKQLSEKTPPVIVAVGYQTNLPFDLNSRAYDYTPAAESRKTDLHSGRF
SRKSGGSNNFRQLLETRIAPKVEQGLNIDRQRRGLWGHSYGGLFVLDSWL
SSSYFRSYYSASPSLGRGYDALLSRVTAVEPLQFCAKHLAIMEGSATQGD
NRETHAVGVLSKIHTTLTILKDKGVNVVFWDFPNLGHGPMFNASFRQALL
DISGENANYTAGCHELSH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYAREYRSTRPHKAIFFHLSCLTLICSAQVYAEPDMRPLGPNIADKGSVF
YHFSTTSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDD
ELLKQLSEKTPPVIVAVGYQTNLPFDLNSRAYDYTPAAESRKTDLHSGRF
SRKSGGSNNFRQLLETRIAPKVEQGLNIDRQRRGLWGHSYGGLFVLDSWL
SSSYFRSYYSASPSLGRGYDALLSRVTAVEPLQFCAKHLAIMEGSATQGD
NRETHAVGVLSKIHTTLTILKDKGVNVVFWDFPNLGHGPMFNASFRQALL
DISGENANYTAGCHELSH


References
20 more
    Title: Structural characterization of enterobactin hydrolase IroE
    Larsen NA, Lin H, Wei R, Fischbach MA, Walsh CT
    Ref: Biochemistry, 45:10184, 2006 : PubMed

            

    Title: Analysis of the genome structure of the nonpathogenic probiotic Escherichia coli strain Nissle 1917
    Grozdanov L, Raasch C, Schulze J, Sonnenborn U, Gottschalk G, Hacker J, Dobrindt U
    Ref: Journal of Bacteriology, 186:5432, 2004 : PubMed

            

    Title: Extensive mosaic structure revealed by the complete genome sequence of uropathogenic Escherichia coli
    Welch RA, Burland V, Plunkett G, 3rd, Redford P, Roesch P, Rasko D, Buckles EL, Liou SR, Boutin A and Blattner FR <9 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 99:17020, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer