human-DPP8

 
Homo sapiens (Human) dipeptidyl peptidase 8 (DPP8)

Comment
Previously called DRP1 Qi et al . Has dpp activity as dpp4 . Q7Z4D3 mstp135 very short sequence with some diff in N-term ?!! Q7Z4C8 mstp141 Q7Z4E1 mstp097


Relationship
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
17 structures (e.g. : 7OZ7, 7A3K, 7OR4... more)
No kinetic


Inhibitor: beta-lactam-A296-1 , beta-lactam-B142 , 4-Oxo-beta-Lactam-A241 , 4-Oxo-beta-Lactam-LMC375 , 4-Oxo-beta-Lactam-A272 , 4-Oxo-beta-Lactam-91-sub , 4-Oxo-beta-Lactam-91 , 4-Oxo-beta-Lactam-B115 , 4-Oxo-beta-Lactam-B114 , beta-lactam-L84 , CHEMBL1214943 , CHEMBL1910111 , SUMO1-EIL , Talabostat , isoquinolinederivative18 , 1G244 , CHEMBL1215376 ,
>3 Genbank links 16 more: AF221634, AAG29766, AF221637
>3 UniProt links 1 more: Q6V1X1, A8K4U2, B4DYW8
1 Ncbi-nid : 11095187
1 Ncbi-pid : 11095188
>3 Structure links 14 more: 7OZ7, 7A3K, 7OR4
>3 UniProtTrembl links 1 more: Q6V1X1, A8K4U2, B4DYW8
>3 Interpro links 1 more: Q6V1X1, A8K4U2, B4DYW8
>3 Prodom links 1 more: Q6V1X1, A8K4U2, B4DYW8
>3 Pfam links 1 more: Q6V1X1, A8K4U2, B4DYW8
>3 PIRSF links 1 more: Q6V1X1, A8K4U2, B4DYW8
>3 SUPERFAM links 1 more: Q6V1X1, A8K4U2, B4DYW8
>3 QuickSwissBlast links 1 more: Q6V1X1, A8K4U2, B4DYW8
1 EntrezGene : 54878
1 SNP : 54878
1 UniGene : 591106
1 HUGO HGNC : 16490
1 IUPHAR : 2356
1 OMIM : 606819
1 Ensembl : ENSG00000074603
 
Sequence
Graphical view for this peptide sequence: human-DPP8
Colored MSA for DPP4N_Peptidase_S9 (raw)
MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLA
DTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYS
EIPKTINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLRERKRIGTVGI
ASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRM
DPKLCPADPDWIAFIHSNDIWISNIVTREERRLTYVHNELANMEEDARSA
GVATFVLQEEFDRYSGYWWCPKAETTPSGGKILRILYEENDESEVEIIHV
TSPMLETRRADSFRYPKTGTANPKVTFKMSEIMIDAEGRIIDVIDKELIQ
PFEILFEGVEYIARAGWTPEGKYAWSILLDRSQTRLQIVLISPELFIPVE
DDVMERQRLIESVPDSVTPLIIYEETTDIWINIHDIFHVFPQSHEEEIEF
IFASECKTGFRHLYKITSILKESKYKRSSGGLPAPSDFKCPIKEEIAITS
GEWEVLGRHGSNIQVDEVRRLVYFEGTKDSPLEHHLYVVSYVNPGEVTRL
TDRGYSHSCCISQHCDFFISKYSNQKNPHCVSLYKLSSPEDDPTCKTKEF
WATILDSAGPLPDYTPPEIFSFESTTGFTLYGMLYKPHDLQPGKKYPTVL
FIYGGPQVQLVNNRFKGVKYFRLNTLASLGYVVVVIDNRGSCHRGLKFEG
AFKYKMGQIEIDDQVEGLQYLASRYDFIDLDRVGIHGWSYGGYLSLMALM
QRSDIFRVAIAGAPVTLWIFYDTGYTERYMGHPDQNEQGYYLGSVAMQAE
KFPSEPNRLLLLHGFLDENVHFAHTSILLSFLVRAGKPYDLQIYPQERHS
IRVPESGEHYELHLLHYLQENLGSRIAALKVI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLA
DTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYS
EIPKTINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLRERKRIGTVGI
ASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRM
DPKLCPADPDWIAFIHSNDIWISNIVTREERRLTYVHNELANMEEDARSA
GVATFVLQEEFDRYSGYWWCPKAETTPSGGKILRILYEENDESEVEIIHV
TSPMLETRRADSFRYPKTGTANPKVTFKMSEIMIDAEGRIIDVIDKELIQ
PFEILFEGVEYIARAGWTPEGKYAWSILLDRSQTRLQIVLISPELFIPVE
DDVMERQRLIESVPDSVTPLIIYEETTDIWINIHDIFHVFPQSHEEEIEF
IFASECKTGFRHLYKITSILKESKYKRSSGGLPAPSDFKCPIKEEIAITS
GEWEVLGRHGSNIQVDEVRRLVYFEGTKDSPLEHHLYVVSYVNPGEVTRL
TDRGYSHSCCISQHCDFFISKYSNQKNPHCVSLYKLSSPEDDPTCKTKEF
WATILDSAGPLPDYTPPEIFSFESTTGFTLYGMLYKPHDLQPGKKYPTVL
FIYGGPQVQLVNNRFKGVKYFRLNTLASLGYVVVVIDNRGSCHRGLKFEG
AFKYKMGQIEIDDQVEGLQYLASRYDFIDLDRVGIHGWSYGGYLSLMALM
QRSDIFRVAIAGAPVTLWIFYDTGYTERYMGHPDQNEQGYYLGSVAMQAE
KFPSEPNRLLLLHGFLDENVHFAHTSILLSFLVRAGKPYDLQIYPQERHS
IRVPESGEHYELHLLHYLQENLGSRIAALKVI

Graphical view for this nucleotide DNA sequence (3202 bp): human-DPP8



References
24 more
    Title: Dipeptidyl peptidase 9 triggers BRCA2 degradation and promotes DNA damage repair
    Bolgi O, Silva-Garcia M, Ross B, Pilla E, Kari V, Killisch M, Spitzner M, Stark N, Lenz C and Geiss-Friedlander R <8 more author(s)>
    Ref: EMBO Rep, :e54136, 2022 : PubMed

            

    Title: Aerosol-based ligand soaking of reservoir-free protein crystals
    Ross B, Krapp S, Geiss-Friedlander R, Littmann W, Huber R, Kiefersauer R
    Ref: J Appl Crystallogr, 54:895, 2021 : PubMed

            

    Title: Dipeptidyl peptidase 9 triggers BRCA2 degradation by the N-degron pathway to promote DNA-damage repair
    Silva-Garcia M, Bolgi O, Ross B, Pilla E, Kari V, Killisch M, Stark N, Lenz C, Spitzner M and Geiss-Friedlander R <5 more author(s)>
    Ref: Biorxiv, :, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer