Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lismo-LMO2089

Listeria monocytogenes, Listeria innocua, Listeria marthii, Listeria welshimeri, hypothetical protein lmo2089

Comment
Other strains: Listeria monocytogenes (strains: FSL N1-017; FSL J2-071; J2818; FSL J1-194; F6900; FSL R2-503; FSL N3-165; HPB2262; serotype 1/2a (strain 08-5578; 08-5923; ATCC BAA-679 / EGD-e; F6854); serotype 4a (strain L99; HCC23); serotype 4b (strain CLIP80459; F2365; H7858), Listeria innocua (FSL J1-023; FSL S4-378; serovar 6a (strain CLIP 11262)), Listeria marthii FSL S4-120, Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334)


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Listeria monocytogenes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria monocytogenes: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AE017329, AL591982, AADQ01000011
3 UniProt : Q929T0, A0AKJ6, Q8Y5H3
3 UniProt : Q8Y5H3, Q929T0, A0AKJ6
3 Interpro : Q8Y5H3, Q929T0, A0AKJ6
3 Pfam : Q8Y5H3, Q929T0, A0AKJ6
3 PIRSF : Q8Y5H3, Q929T0, A0AKJ6
3 SUPERFAM : Q8Y5H3, Q929T0, A0AKJ6
Sequence
Graphical view for this peptide sequence: lismo-LMO2089
Colored MSA for Hormone-sensitive_lipase_like (raw)
MKNTIKWIAIGFAGIILLPLLIVFFIYKKAVGKKDYNPEVLENLDKASQE
FVKNTSPLSDVDSRYKYMRLATKALPSAKDIEIGDVENKKIDGPAGKIPI
RIYTPQEDGPFEIIVYYHGGGFVLGGLQTHDAIARKLVQTTGARVVTVDY
RLAPENPFPAAVEDAYAALLWVQNHRTSLRAKSSDIIVAGDSVGGNLATV
VTQIAKSKGKPNITAQILLYPATDIFSRDASVLYPSMDEFAEGYVLTKES
LDKFFKLYIANASDRKYDPLVAPIRSKDLVGLPKTFIATAEFDPLRDQGE
AYAKKLKDAGVEVFAKRFEKVPHGFMTTNSEATDETYELISEFLEEK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKNTIKWIAIGFAGIILLPLLIVFFIYKKAVGKKDYNPEVLENLDKASQE
FVKNTSPLSDVDSRYKYMRLATKALPSAKDIEIGDVENKKIDGPAGKIPI
RIYTPQEDGPFEIIVYYHGGGFVLGGLQTHDAIARKLVQTTGARVVTVDY
RLAPENPFPAAVEDAYAALLWVQNHRTSLRAKSSDIIVAGDSVGGNLATV
VTQIAKSKGKPNITAQILLYPATDIFSRDASVLYPSMDEFAEGYVLTKES
LDKFFKLYIANASDRKYDPLVAPIRSKDLVGLPKTFIATAEFDPLRDQGE
AYAKKLKDAGVEVFAKRFEKVPHGFMTTNSEATDETYELISEFLEEK


References
4 more
    Title: Comparative genomics of the bacterial genus Listeria: Genome evolution is characterized by limited gene acquisition and limited gene loss
    den Bakker HC, Cummings CA, Ferreira V, Vatta P, Orsi RH, Degoricija L, Barker M, Petrauskene O, Furtado MR, Wiedmann M
    Ref: BMC Genomics, 11:688, 2010 : PubMed

            

    Title: Whole genome comparisons of serotype 4b and 1/2a strains of the food-borne pathogen Listeria monocytogenes reveal new insights into the core genome components of this species
    Nelson KE, Fouts DE, Mongodin EF, Ravel J, DeBoy RT, Kolonay JF, Rasko DA, Angiuoli SV, Gill SR and Fraser CM <23 more author(s)>
    Ref: Nucleic Acids Research, 32:2386, 2004 : PubMed

            

    Title: Comparative genomics of Listeria species
    Glaser P, Frangeul L, Buchrieser C, Rusniok C, Amend A, Baquero F, Berche P, Bloecker H, Brandt P and Cossart P <45 more author(s)>
    Ref: Science, 294:849, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer