Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lismo-LMO2452

Listeria monocytogenes, Listeria welshimeri, Listeria seeligeri, Listeria marthii, Listeria innocua, Listeria ivanovii, hypothetical protein lmo2452

Comment
Seem to lack active Ser. Other strains: Listeria monocytogenes (and serotype 4a (strain HCC23; serotype 4b (strain Clip81459; F2365); FSL N3-165; FSL R2-503; FSL J2-071; FSL N1-017; HPB2262; J2818; FSL J1-194; F6900; serotype 1/2a (strain 08-5578; 08-5923); serotype 4c (strain L99); FSL F2-208; J1816; J1-220; Scott A) Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) FSL F2-208; serotype 4b str. LL195; serotype 4a (strain M7)) Listeria seeligeri (strain serovar 1/2b ATCC 35967 / DSM 20751 / CI100100 / SLCC 3954; FSL N1-067; FSL S4-171) Listeria marthii (FSL S4-120) Listeria innocua (FSL S4-378; FSL J1-023; ATCC 33091) Listeria ivanovii (FSL F6-596; subsp. londoniensis; ATCC BAA-678 / PAM 55); Listeria aquatica FSL S10-1188; Listeria grayi FSL F6-1183


Relationship
Family|CarbLipBact_1
Block| X
Position in NCBI Life Tree|Listeria monocytogenes
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria monocytogenes: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 37 more: AL591983, AM263198, CP001175
>3 UniProt links 7 more: A0ALD6, E3ZT97, H1GEM7
>3 UniProt links 9 more: Q8Y4I7, A0ALD6, E3ZT97
>3 Interpro links 9 more: Q8Y4I7, A0ALD6, E3ZT97
>3 Pfam links 9 more: Q8Y4I7, A0ALD6, E3ZT97
>3 PIRSF links 9 more: Q8Y4I7, A0ALD6, E3ZT97
>3 SUPERFAM links 9 more: Q8Y4I7, A0ALD6, E3ZT97
Sequence
Graphical view for this peptide sequence: lismo-LMO2452
Colored MSA for CarbLipBact_1 (raw)
MSADRSFTLKAGNRAVLLLHGFAGTTEDVRELGEILAENGYTVHAPNFRG
HGDEPAIFLKTTPEMWYEDAVAGYRQLEKDGYNEIAIVGVAMGGVFALKM
AESFSPKAIVPLCANVNRKMRYIPIENYLTKQLKKQGIVEQEADQMLKNY
LPEIDVMTEARATFYKNVARDIEKIHVPTMIGQGCQDEEIDADNANYIFK
HIHTNDKQLCFYAGSGHDIVNDCEKDILEEDLIYFLDDLVWLEEKVV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSADRSFTLKAGNRAVLLLHGFAGTTEDVRELGEILAENGYTVHAPNFRG
HGDEPAIFLKTTPEMWYEDAVAGYRQLEKDGYNEIAIVGVAMGGVFALKM
AESFSPKAIVPLCANVNRKMRYIPIENYLTKQLKKQGIVEQEADQMLKNY
LPEIDVMTEARATFYKNVARDIEKIHVPTMIGQGCQDEEIDADNANYIFK
HIHTNDKQLCFYAGSGHDIVNDCEKDILEEDLIYFLDDLVWLEEKVV


References
9 more
    Title: High-throughput genome sequencing of two Listeria monocytogenes clinical isolates during a large foodborne outbreak
    Gilmour MW, Graham M, Van Domselaar G, Tyler S, Kent H, Trout-Yakel KM, Larios O, Allen V, Lee B, Nadon C
    Ref: BMC Genomics, 11:120, 2010 : PubMed

            

    Title: Whole-genome sequence of Listeria welshimeri reveals common steps in genome reduction with Listeria innocua as compared to Listeria monocytogenes
    Hain T, Steinweg C, Kuenne CT, Billion A, Ghai R, Chatterjee SS, Domann E, Karst U, Goesmann A and Chakraborty T <12 more author(s)>
    Ref: Journal of Bacteriology, 188:7405, 2006 : PubMed

            

    Title: Comparative genomics of Listeria species
    Glaser P, Frangeul L, Buchrieser C, Rusniok C, Amend A, Baquero F, Berche P, Bloecker H, Brandt P and Cossart P <45 more author(s)>
    Ref: Science, 294:849, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer