Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ratno-dpp4

Rattus norvegicus (Rat) Dipeptidyl peptidase IV (DPP)

Comment
Belongs to peptidase family s9B a very short sequence (fragment) from Cricetulus griseus (Chinese hamster) is almost identical Trembl Q99J96


Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Rattus norvegicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E


Molecular evidence
Database
No mutation
9 structures (e.g. : 2GBC, 2GBF, 2GBG... more)
No kinetic





No Substrate
5 inhibitors (e.g. : AIL, Alkynyl-cyanopyrrolidine-1, Alkynyl-cyanopyrrolidine-2... more)
>3 Genbank links 1 more: J04591, J02997, AF307315
2 UniProt : P14740, F1M7X5
1 Ncbi-nid : 203973
1 Ncbi-pid : 203974
>3 Structure links 6 more: 4FFV, 4FFW, 5VTA
3 UniProt : P14740, Q99J96, F1M7X5
3 Interpro : P14740, Q99J96, F1M7X5
3 Prodom : P14740, Q99J96, F1M7X5
3 Pfam : P14740, Q99J96, F1M7X5
3 PIRSF : P14740, Q99J96, F1M7X5
3 SUPERFAM : P14740, Q99J96, F1M7X5
Sequence
Graphical view for this peptide sequence: ratno-dpp4
Colored MSA for DPP4N_Peptidase_S9 (raw)
MKTPWKVLLGLLGVAALVTIITVPVVLLNKDEAAADSARTYTLADYLKNT
FRVKSYSLRWVSDSEYLYKQENNILLFNAEHGNSSIFLENSTFEIFGDSI
SDYSVSPDRLFVLLEYNYVKQWRHSYTASYSIYDLNKRQLITEEKIPNNT
QWITWSQEGHKLAYVWKNDIYVKIEPHLPSHRITSTGKENVIFNGINDWV
YEEEIFGAYSALWWSPNGTFLAYAQFNDTGVPLIEYSFYSDESLQYPKTV
WIPYPKAGAVNPTVKFFIVNTDSLSSTTTTIPMQITAPASVTTGDHYLCD
VAWVSEDRISLQWLRRIQNYSVMAICDYDKTTLVWNCPTTQEHIETSATG
WCGRFRPAEPHFTSDGSSFYKIVSDKDGYKHICQFQKDRKPEQVCTFITK
GAWEVISIEALTSDYLYYISNEYKEMPGGRNLYKIQLTDHTNKKCLSCDL
NPERCQYYSVSLSKEAKYYQLGCRGPGLPLYTLHRSTDQKELRVLEDNSA
LDKMLQDVQMPSKKLDFIVLNETRFWYQMILPPHFDKSKKYPLLIDVYAG
PCSQKADAAFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINKRLG
TLEVEDQIEAARQFLKMGFVDSKRVAIWGWSYGGYVTSMVLGSGSGVFKC
GIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVE
YLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQ
HIYSHMSHFLQQCFSLR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKTPWKVLLGLLGVAALVTIITVPVVLLNKDEAAADSARTYTLADYLKNT
FRVKSYSLRWVSDSEYLYKQENNILLFNAEHGNSSIFLENSTFEIFGDSI
SDYSVSPDRLFVLLEYNYVKQWRHSYTASYSIYDLNKRQLITEEKIPNNT
QWITWSQEGHKLAYVWKNDIYVKIEPHLPSHRITSTGKENVIFNGINDWV
YEEEIFGAYSALWWSPNGTFLAYAQFNDTGVPLIEYSFYSDESLQYPKTV
WIPYPKAGAVNPTVKFFIVNTDSLSSTTTTIPMQITAPASVTTGDHYLCD
VAWVSEDRISLQWLRRIQNYSVMAICDYDKTTLVWNCPTTQEHIETSATG
WCGRFRPAEPHFTSDGSSFYKIVSDKDGYKHICQFQKDRKPEQVCTFITK
GAWEVISIEALTSDYLYYISNEYKEMPGGRNLYKIQLTDHTNKKCLSCDL
NPERCQYYSVSLSKEAKYYQLGCRGPGLPLYTLHRSTDQKELRVLEDNSA
LDKMLQDVQMPSKKLDFIVLNETRFWYQMILPPHFDKSKKYPLLIDVYAG
PCSQKADAAFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINKRLG
TLEVEDQIEAARQFLKMGFVDSKRVAIWGWSYGGYVTSMVLGSGSGVFKC
GIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVE
YLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQ
HIYSHMSHFLQQCFSLR


References
7 more
    Title: Structure-guided Discovery of Dual-recognition Chemibodies
    Cheng AC, Doherty EM, Johnstone S, DiMauro EF, Dao J, Luthra A, Ye J, Tang J, Nixey T and Wang Z <3 more author(s)>
    Ref: Sci Rep, 8:7570, 2018 : PubMed

            

    Title: An Inhibitory Antibody against Dipeptidyl Peptidase IV Improves Glucose Tolerance in Vivo
    Tang J, Majeti J, Sudom A, Xiong Y, Lu M, Liu Q, Higbee J, Zhang Y, Wang Y and Wang Z <12 more author(s)>
    Ref: Journal of Biological Chemistry, 288:1307, 2013 : PubMed

            

    Title: Primary structure of rat liver dipeptidyl peptidase IV deduced from its cDNA and identification of the NH2-terminal signal sequence as the membrane-anchoring domain
    Ogata S, Misumi Y, Ikehara Y
    Ref: Journal of Biological Chemistry, 264:3596, 1989 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer