Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ratno-dpp6

Rattus norvegicus (Rat) Dipeptidyl aminopeptidase-like protein 6 (dipeptidylpeptidase VI) (dppx)

Comment
Rattus sp bspl, neural membrane cd26 peptidase-like protein


Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Rattus norvegicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : M76426, M76427
2 UniProt : P46101, F1LMR7
2 UniProt : P46101, F1LMR7
2 Interpro : P46101, F1LMR7
2 Pfam : P46101, F1LMR7
2 PIRSF : P46101, F1LMR7
2 SUPERFAM : P46101, F1LMR7
Sequence
Graphical view for this peptide sequence: ratno-dpp6
Colored MSA for DPP4N_Peptidase_S9 (raw)
MASLYQRFTGKINTSRSFPAPPEASHLLGGQGPEEDAGSKPLGPQAQAVA
PRERGGAGGRPRFQYQARSDCDEEDELVGSNPPQRNWKGIAIALLVILVI
CSLIVTSVILLTPAEDTSLSQKKKVTVEDLFSEDFKIHDPEAKWISDKEF
IYRERKGSVILRNVETNNSTVLIEGKKIESLRAIRYEISPDKEYALFSYN
VEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIF
IFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKSHIAHWW
SPDGTRLAYATINDSRVPLMELPTYTGSVYPTVKPYHYPKAGSENPSISL
HVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVS
ILTLCDATTGVCTKKHEDESEAWLHRQNEEPVFSKDGRKFFFVRAIPQGG
RGKFYHITVSSSQPNSSNDNIQSITSGDWDVTEILTYDEKRNKLYFLSTE
DLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFSHNMDFFLLKCEG
PGVPTVTVHNTTDKRRMFDLEANEQVQKAIYDRQMPKIEYRKIEVEDYSL
PMQILKPATFTDTAHYPLLLVVDGTPGSQSVSERFEVTWETVLVSSHGAV
VVKCDGRGSGFQGTKLLHEVRRRLGFLEEKDQMEAVRTMLKEQYIDKTRV
AVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERY
LGLHGLDNRAYEMTKLAHRVSALEDQQFLIIHATADEKIHFQHTAELITQ
LIKGKANYSLQIYPDESHYFHSVALKQHLYRSIIGFFVECFRIQDKLPTA
TAKEDEEED
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASLYQRFTGKINTSRSFPAPPEASHLLGGQGPEEDAGSKPLGPQAQAVA
PRERGGAGGRPRFQYQARSDCDEEDELVGSNPPQRNWKGIAIALLVILVI
CSLIVTSVILLTPAEDTSLSQKKKVTVEDLFSEDFKIHDPEAKWISDKEF
IYRERKGSVILRNVETNNSTVLIEGKKIESLRAIRYEISPDKEYALFSYN
VEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIF
IFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKSHIAHWW
SPDGTRLAYATINDSRVPLMELPTYTGSVYPTVKPYHYPKAGSENPSISL
HVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVS
ILTLCDATTGVCTKKHEDESEAWLHRQNEEPVFSKDGRKFFFVRAIPQGG
RGKFYHITVSSSQPNSSNDNIQSITSGDWDVTEILTYDEKRNKLYFLSTE
DLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFSHNMDFFLLKCEG
PGVPTVTVHNTTDKRRMFDLEANEQVQKAIYDRQMPKIEYRKIEVEDYSL
PMQILKPATFTDTAHYPLLLVVDGTPGSQSVSERFEVTWETVLVSSHGAV
VVKCDGRGSGFQGTKLLHEVRRRLGFLEEKDQMEAVRTMLKEQYIDKTRV
AVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERY
LGLHGLDNRAYEMTKLAHRVSALEDQQFLIIHATADEKIHFQHTAELITQ
LIKGKANYSLQIYPDESHYFHSVALKQHLYRSIIGFFVECFRIQDKLPTA
TAKEDEEED


References
    Title: Genome sequence of the Brown Norway rat yields insights into mammalian evolution
    Gibbs RA, Weinstock GM, Metzker ML, Muzny DM, Sodergren EJ, Scherer S, Scott G, Steffen D, Worley KC and Collins F <218 more author(s)>
    Ref: Nature, 428:493, 2004 : PubMed

            

    Title: Transcripts encoding a neural membrane CD26 peptidase-like protein are stimulated by synaptic activity
    de Lecea L, Soriano E, Criado JR, Steffensen SC, Henriksen SJ, Sutcliffe JG
    Ref: Brain Research Mol Brain Res, 25:286, 1994 : PubMed

            

    Title: Differential expression of two distinct forms of mRNA encoding members of a dipeptidyl aminopeptidase family
    Wada K, Yokotani N, Hunter C, Doi K, Wenthold RJ, Shimasaki S
    Ref: Proc Natl Acad Sci U S A, 89:197, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer