arath-MES14

 
Arabidopsis thaliana, Arabidopsis lyrata, AtMES14 MES14 At1g33990 T15K4.4 F12G12.19, F12G12.220, polyneuridine aldehyde esterase putative

Comment
Other strains: Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)


Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 6 more: AC079286, AC015446, AY088607
2 UniProt : Q9FVW3, D7KJC8
1 Ncbi-nid : 10092440
1 Ncbi-pid : 10092445
2 UniProtTrembl : Q9FVW3, D7KJC8
2 Interpro : Q9FVW3, D7KJC8
2 Prodom : Q9FVW3, D7KJC8
2 Pfam : Q9FVW3, D7KJC8
2 PIRSF : Q9FVW3, D7KJC8
2 SUPERFAM : Q9FVW3, D7KJC8
2 QuickSwissBlast : Q9FVW3, D7KJC8
1 Tair database : At1g33990
 
Sequence
Graphical view for this peptide sequence: arath-MES14
Colored MSA for Hydroxynitrile_lyase (raw)
MGNKIISMMKKDSKDGGGGGSKSKRMNRSQRKLLADEEMLHRRALSMAIH
QAQLSQRFDGSMSRRVGSTSTRKRTLSDPFSNGKQVPDFSESLIVKKFVL
VHGEGFGAWCWYKMVASLEESGLSPVTVDLTGCGFNMTDTNTVSTLEEYS
KPLIDLLENLPEEEKVILVGHSTGGASISYALERFPEKISKAIFVCATMV
SDGQRPFDVFSEELGSAERFMKESQFLIYGNGKDKPPTGFMFEKPHMKGL
YFNQSPNKDIALAMISMRPVPLGPMMEKVSLTAERYGKGRRFYVQTLDDR
ALSPDVQEKLVRENSPEGVFKIKGSDHCPFFSKPQSLHKILLEIAQIP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGNKIISMMKKDSKDGGGGGSKSKRMNRSQRKLLADEEMLHRRALSMAIH
QAQLSQRFDGSMSRRVGSTSTRKRTLSDPFSNGKQVPDFSESLIVKKFVL
VHGEGFGAWCWYKMVASLEESGLSPVTVDLTGCGFNMTDTNTVSTLEEYS
KPLIDLLENLPEEEKVILVGHSTGGASISYALERFPEKISKAIFVCATMV
SDGQRPFDVFSEELGSAERFMKESQFLIYGNGKDKPPTGFMFEKPHMKGL
YFNQSPNKDIALAMISMRPVPLGPMMEKVSLTAERYGKGRRFYVQTLDDR
ALSPDVQEKLVRENSPEGVFKIKGSDHCPFFSKPQSLHKILLEIAQIP

Graphical view for this nucleotide DNA sequence (2039 bp): arath-MES14



References
5 more
    Title: Empirical analysis of transcriptional activity in the Arabidopsis genome
    Yamada K, Lim J, Dale JM, Chen H, Shinn P, Palm CJ, Southwick AM, Wu HC, Kim C and Ecker JR <60 more author(s)>
    Ref: Science, 302:842, 2003 : PubMed

            

    Title: Full-length messenger RNA sequences greatly improve genome annotation
    Haas BJ, Volfovsky N, Town CD, Troukhan M, Alexandrov N, Feldmann KA, Flavell RB, White O, Salzberg SL
    Ref: Genome Biol, 3:RESEARCH0029, 2002 : PubMed

            

    Title: Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana
    Theologis A, Ecker JR, Palm CJ, Federspiel NA, Kaul S, White O, Alonso J, Altafi H, Araujo R and Davis RW <79 more author(s)>
    Ref: Nature, 408:816, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer