arath-PLA17

 
Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), PLA17 At1g51440 F5D21.19 hypothetical 60.3 kda protein

Relationship
Block L
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : AC024261
2 UniProt : D7KHS3, Q9C8J6
2 UniProtTrembl : Q9C8J6, D7KHS3
2 Interpro : Q9C8J6, D7KHS3
2 Prodom : Q9C8J6, D7KHS3
2 Pfam : Q9C8J6, D7KHS3
2 PIRSF : Q9C8J6, D7KHS3
2 SUPERFAM : Q9C8J6, D7KHS3
2 QuickSwissBlast : Q9C8J6, D7KHS3
1 Tair database : At1g51440
 
Sequence
Graphical view for this peptide sequence: arath-PLA17
Colored MSA for Plant_phospholipase (raw)
MASLSLPITLKNPRFFSSSPQNIFKTQPQTLVLTTKFKTCSIICSSSCTS
ISSSTTQQKQSNKQTHVSDNKREEKAEEEEEEKEVSLREIWREVQGCNNW
EGQLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHPSDFFL
NLDLHLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGFVAVA
TDEEEVSRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPSIKIEL
GFHDLYTKKEDSCKFSSFSAREQVLAEVKRLIEYYGTEEEGHKTSITVTG
HSLGASLALVSAYDIAELNLNHVPENNYKIPITVFSFSGPRVGNLRFKER
CDELGVKVLRVVNVHDKVPSVPGIFTNEKFQFQKYVEEKTSFPWSYAHVG
VELALDHKKSPFLKPTKDLGCAHNLEALLHLVDGYHGKDEEAEKRFCLVT
KRDIALVNKSCDFLRGEYHVPPCWRQDENKGMVKNGDGQWVLPDRPLLEP
HGPEDIAHHLQQVLGKVNDDNFKPTTT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASLSLPITLKNPRFFSSSPQNIFKTQPQTLVLTTKFKTCSIICSSSCTS
ISSSTTQQKQSNKQTHVSDNKREEKAEEEEEEKEVSLREIWREVQGCNNW
EGQLDPMNNHLRREIIRYGEFAQACYDSFDFDPHSKYCGSCKYHPSDFFL
NLDLHLHKGYTITRYLYATSNINLPNFFQKSKLSSIWSQHANWMGFVAVA
TDEEEVSRLGRRDIVIAWRGTVTYLEWIYDLKDILCSANFGDDPSIKIEL
GFHDLYTKKEDSCKFSSFSAREQVLAEVKRLIEYYGTEEEGHKTSITVTG
HSLGASLALVSAYDIAELNLNHVPENNYKIPITVFSFSGPRVGNLRFKER
CDELGVKVLRVVNVHDKVPSVPGIFTNEKFQFQKYVEEKTSFPWSYAHVG
VELALDHKKSPFLKPTKDLGCAHNLEALLHLVDGYHGKDEEAEKRFCLVT
KRDIALVNKSCDFLRGEYHVPPCWRQDENKGMVKNGDGQWVLPDRPLLEP
HGPEDIAHHLQQVLGKVNDDNFKPTTT

no DNA




References
4 more
    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            

    Title: Empirical analysis of transcriptional activity in the Arabidopsis genome
    Yamada K, Lim J, Dale JM, Chen H, Shinn P, Palm CJ, Southwick AM, Wu HC, Kim C and Ecker JR <60 more author(s)>
    Ref: Science, 302:842, 2003 : PubMed

            

    Title: Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana
    Theologis A, Ecker JR, Palm CJ, Federspiel NA, Kaul S, White O, Alonso J, Altafi H, Araujo R and Davis RW <79 more author(s)>
    Ref: Nature, 408:816, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer