(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Firmicutes: NE > Bacilli: NE > Bacillales: NE > Bacillaceae: NE > Bacillus: NE > Bacillus cereus group: NE > Bacillus anthracis: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Bacillus thuringiensis serovar konkukian: N, E.
Bacillus thuringiensis subsp. konkukian: N, E.
Bacillus thuringiensis serovar konkukian str. 97-27: N, E.
Bacillus anthracis str. Ames: N, E.
Bacillus anthracis str. CDC 684: N, E.
Bacillus anthracis str. A0465: N, E.
Bacillus anthracis str. A0248: N, E.
Bacillus anthracis str. A0488: N, E.
Bacillus anthracis str. A0193: N, E.
Bacillus anthracis str. A0442: N, E.
Bacillus anthracis str. A0389: N, E.
Bacillus anthracis str. A0174: N, E.
Bacillus anthracis Tsiankovskii-I: N, E.
Bacillus anthracis str. A2012: N, E.
Bacillus anthracis str. BF1: N, E.
Bacillus anthracis str. SVA11: N, E.
Bacillus anthracis str. H9401: N, E.
Bacillus anthracis str. A16: N, E.
Bacillus anthracis CZC5: N, E.
Bacillus anthracis 8903-G: N, E.
Bacillus anthracis 9080-G: N, E.
Bacillus anthracis 52-G: N, E.
Bacillus anthracis str. A16R: N, E.
Bacillus anthracis str. UR-1: N, E.
Bacillus anthracis str. Tsiankovskii-I: N, E.
Bacillus cereus G9241: N, E.
Bacillus cereus AH1272: N, E.
Bacillus cereus AH1273: N, E.
Bacillus thuringiensis str. Al Hakam: N, E.
Bacillus cereus NVH0597-99: N, E.
Bacillus cereus 95/8201: N, E.
Bacillus thuringiensis serovar monterrey BGSC 4AJ1: N, E.
Bacillus cereus W: N, E.
Bacillus cereus 03BB108: N, E.
Bacillus cereus Rock3-42: N, E.
Bacillus thuringiensis serovar pulsiensis BGSC 4CC1: N, E.
Bacillus cereus m1293: N, E.
Bacillus thuringiensis serovar andalousiensis BGSC 4AW1: N, E.
Bacillus cereus AH820: N, E.
Bacillus thuringiensis serovar tochigiensis BGSC 4Y1: N, E.
Bacillus cereus BGSC 6E1: N, E.
Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1: N, E.
Bacillus cereus 03BB102: N, E.
Bacillus cereus BDRD-ST26: N, E.
Bacillus cereus AH187: N, E.
Bacillus cereus H3081.97: N, E.
Bacillus cereus R309803: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MNQTIGRIEEISFYSASLQEDVTLLVYLPVNYTPLHKHTVVIAQDGRDYF QLGKAHRVIERLRETEEIDRTIIVGIPYKNVHDRKEKYFPNEVKNAAYIR FLAHELAPYIDENYPTYQMGKGRVLIGDSLGGTVSFMTALMYPHTFGKVV MQSPFVDETVMNLAKDFKNPEALELYHVIGTEETAVKRTDGQVSDFVGPN RELNTLLTDRNFITHYEEFEGNHTWKYWQTDLPKAFSHMLSMK
Bacillus thuringiensis is an insect pathogen that is widely used as a biopesticide (E. Schnepf, N. Crickmore, J. Van Rie, D. Lereclus, J. Baum, J. Feitelson, D. R. Zeigler, and D. H. Dean, Microbiol. Mol. Biol. Rev. 62:775-806, 1998). Here we report the finished, annotated genome sequence of B. thuringiensis Al Hakam, which was collected in Iraq by the United Nations Special Commission (L. Radnedge, P. Agron, K. Hill, P. Jackson, L. Ticknor, P. Keim, and G. Andersen, Appl. Environ. Microbiol. 69:2755-2764, 2003).
Bacillus anthracis is the etiologic agent of anthrax, an acute fatal disease among mammals. It was thought to differ from Bacillus cereus, an opportunistic pathogen and cause of food poisoning, by the presence of plasmids pXO1 and pXO2, which encode the lethal toxin complex and the poly-gamma-d-glutamic acid capsule, respectively. This work describes a non-B. anthracis isolate that possesses the anthrax toxin genes and is capable of causing a severe inhalation anthrax-like illness. Although initial phenotypic and 16S rRNA analysis identified this isolate as B. cereus, the rapid generation and analysis of a high-coverage draft genome sequence revealed the presence of a circular plasmid, named pBCXO1, with 99.6% similarity with the B. anthracis toxin-encoding plasmid, pXO1. Although homologues of the pXO2 encoded capsule genes were not found, a polysaccharide capsule cluster is encoded on a second, previously unidentified plasmid, pBC218. A/J mice challenged with B. cereus G9241 confirmed the virulence of this strain. These findings represent an example of how genomics could rapidly assist public health experts responding not only to clearly identified select agents but also to novel agents with similar pathogenic potentials. In this study, we combined a public health approach with genome analysis to provide insight into the correlation of phenotypic characteristics and their genetic basis.
Bacillus anthracis is an endospore-forming bacterium that causes inhalational anthrax. Key virulence genes are found on plasmids (extra-chromosomal, circular, double-stranded DNA molecules) pXO1 (ref. 2) and pXO2 (ref. 3). To identify additional genes that might contribute to virulence, we analysed the complete sequence of the chromosome of B. anthracis Ames (about 5.23 megabases). We found several chromosomally encoded proteins that may contribute to pathogenicity--including haemolysins, phospholipases and iron acquisition functions--and identified numerous surface proteins that might be important targets for vaccines and drugs. Almost all these putative chromosomal virulence and surface proteins have homologues in Bacillus cereus, highlighting the similarity of B. anthracis to near-neighbours that are not associated with anthrax. By performing a comparative genome hybridization of 19 B. cereus and Bacillus thuringiensis strains against a B. anthracis DNA microarray, we confirmed the general similarity of chromosomal genes among this group of close relatives. However, we found that the gene sequences of pXO1 and pXO2 were more variable between strains, suggesting plasmid mobility in the group. The complete sequence of B. anthracis is a step towards a better understanding of anthrax pathogenesis.
Bacillus anthracis (strain Ames) hydrolase, and Bacillus cereus (strain ATCC 10987) alpha/beta fold family