Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-Ces1c

Mus musculus mRNA for carboxylesterase, Ces1c lung surfactant convertase, Liver carboxylesterase N, PES-N clone MGC:18575

Comment
replaces mouse-cxest, mouse-sfest, mouse-cxestb


Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Simvastatin
2 inhibitors: ABP-C6, NBD-HE-HP
>3 Genbank links 7 more: L11333, M57960, AF034435
1 UniProt : P23953
>3 Ncbi-nid links 1 more: 192853, 2921307, 22135639
2 Ncbi-pid : 2921308, 22135640
2 UniProt : P23953, A0A1D5RM42
2 Interpro : P23953, A0A1D5RM42
2 Prodom : P23953, A0A1D5RM42
2 Pfam : P23953, A0A1D5RM42
2 PIRSF : P23953, A0A1D5RM42
2 SUPERFAM : P23953, A0A1D5RM42
1 MGD : 95420
1 ENSEMBL : ENSMUSG00000057400
Sequence
Graphical view for this peptide sequence: mouse-Ces1c
Colored MSA for Carb_B_Chordata (raw)
MWLHVLVWASLAVCPILGHSLLPPVVDTTQGKVLGKYISLEGFEQPVAVF
LGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDM
FSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGRS
PYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSQGNWAHLDQLAALRW
VQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVV
INTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKL
VQYNISLSTVIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMM
LQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEKYLRGVDDPAKK
SELILDMFGDIFFGIPAVLMSRSLRDAGVSTYMYEFRYRPSFVSDKRPQM
VEGDHGDEIFSVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEG
LPHWPEYDEKEGYLQIGATTQQAQRLKAEEVAFWTELPAKNPPETDPTEH
TEHK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWLHVLVWASLAVCPILGHSLLPPVVDTTQGKVLGKYISLEGFEQPVAVF
LGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDM
FSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGRS
PYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSQGNWAHLDQLAALRW
VQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVV
INTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKL
VQYNISLSTVIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMM
LQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEKYLRGVDDPAKK
SELILDMFGDIFFGIPAVLMSRSLRDAGVSTYMYEFRYRPSFVSDKRPQM
VEGDHGDEIFSVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEG
LPHWPEYDEKEGYLQIGATTQQAQRLKAEEVAFWTELPAKNPPETDPTEH
TEHK


References
4 more
    Title: Molecular cloning, characterization, and differential expression pattern of mouse lung surfactant convertase
    Krishnasamy S, Teng AL, Dhand R, Schultz RM, Gross NJ
    Ref: American Journal of Physiology, 275:L969, 1998 : PubMed

            

    Title: Lung surfactant convertase is a member of the carboxylesterase family
    Krishnasamy S, Gross NJ, Teng AL, Schultz RM, Dhand R
    Ref: Biochemical & Biophysical Research Communications, 235:180, 1997 : PubMed

            

    Title: Characterization of a murine cDNA encoding a member of the carboxylesterase multigene family
    Ovnic M, Tepperman K, Medda S, Elliott RW, Stephenson DA, Grant SG, Ganschow RE
    Ref: Genomics, 9:344, 1991 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer