Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-Ces3b

Mus musculus (Mouse) Liver carboxylesterase 31-like, Es31L

Comment
Es31L Ces3b ENSMUSG00000062181 in acluster of esterase on Chr8. Old Comment: Q91XD5 and Q8VCU1 are the same gene with some alternative splicing gene just downstream of ES31 mouse-lcxes.Alhough different they have the same MGD entry.Another gene mouse-cxesc ( obsolete) encompass both mouse-lcxes mouse-Ces3b and share some exons see ENSMUSG00000031886 this hypothetical gene is close to mesau-cxest2


Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: BC010812, BC019147, XP_488148
3 UniProt : Q8VCU1, Q8VCU1, G3UYS7
2 UniProt : Q8VCU1, G3UYS7
2 Interpro : Q8VCU1, G3UYS7
2 Prodom : Q8VCU1, G3UYS7
2 Pfam : Q8VCU1, G3UYS7
2 PIRSF : Q8VCU1, G3UYS7
2 SUPERFAM : Q8VCU1, G3UYS7
2 MGD : 102773, 3644960
1 ENSEMBL : ENSMUSG00000062181
Sequence
Graphical view for this peptide sequence: mouse-Ces3b
Colored MSA for Carb_B_Chordata (raw)
MRTMIPAGSSVLVWVTCLLLAFVTTVTGPKVIQPEVDTPLGRVRGRQVGV
KDTDRMVNVFLGIPFAQAPVGPLRFSAPLPPQPWEGVRDASINPPMCLQD
VEKMINSRFGLNEKIKIFPISEDCLTLNIYSPTEITAGDKRPVMVWIHGG
SLLVGSSTSQDGSALAAYGDVVVVTVQYRLGIFGFLSTGDKHMPGNRGFL
DVVAALRWVQGNIAPFGGDPNCVTIFGNSAGGMIVSSLFLSPISAGLFHR
AISQSGIVTTIMMEDMKPWPEAQNFANSVACGSASPAELVQCLLQKEGKD
LIKQKNVNISYIVNDSFFPQRPEKLLADQQFPTVPYLLGVTNHEFGWLLL
KSLNILDKLEHLSREDLLEISRPFLAIMEVPPEIMPTVIDEYLDNGSDQS
ATRYAFQELLGDISFIIPTLNFSKYLRDAGCPVFLYEFQHTPSSFAKFKP
AWVKADHASENSFVFGGPFLTDESSLLAFPEATEEEKQLSLTMMAQWSQF
ARTGNPNGKGLPPWPQLNQLEQYLEIGLESRTGVKLKKGRLQFWTETLPR
KIQEWHREQRSRKVPEEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRTMIPAGSSVLVWVTCLLLAFVTTVTGPKVIQPEVDTPLGRVRGRQVGV
KDTDRMVNVFLGIPFAQAPVGPLRFSAPLPPQPWEGVRDASINPPMCLQD
VEKMINSRFGLNEKIKIFPISEDCLTLNIYSPTEITAGDKRPVMVWIHGG
SLLVGSSTSQDGSALAAYGDVVVVTVQYRLGIFGFLSTGDKHMPGNRGFL
DVVAALRWVQGNIAPFGGDPNCVTIFGNSAGGMIVSSLFLSPISAGLFHR
AISQSGIVTTIMMEDMKPWPEAQNFANSVACGSASPAELVQCLLQKEGKD
LIKQKNVNISYIVNDSFFPQRPEKLLADQQFPTVPYLLGVTNHEFGWLLL
KSLNILDKLEHLSREDLLEISRPFLAIMEVPPEIMPTVIDEYLDNGSDQS
ATRYAFQELLGDISFIIPTLNFSKYLRDAGCPVFLYEFQHTPSSFAKFKP
AWVKADHASENSFVFGGPFLTDESSLLAFPEATEEEKQLSLTMMAQWSQF
ARTGNPNGKGLPPWPQLNQLEQYLEIGLESRTGVKLKKGRLQFWTETLPR
KIQEWHREQRSRKVPEEL


References
    Title: Lineage-specific biology revealed by a finished genome assembly of the mouse
    Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL and Ponting CP <21 more author(s)>
    Ref: PLoS Biol, 7:e1000112, 2009 : PubMed

            

    Title: A comparison of whole-genome shotgun-derived mouse chromosome 16 and the human genome
    Mural RJ, Adams MD, Myers EW, Smith HO, Miklos GL, Wides R, Halpern A, Li PW, Sutton GG and Stephenson LD <169 more author(s)>
    Ref: Science, 296:1661, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer