Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ratno-Ces1e

Rattus norvegicus (Rat) Liver carboxylesterase Carboxylesterase 1E ES-3 (egasyn)

Comment
Trembl Q64646 is the C-terminus Rattus rattus (Black rat) . Trembl Q6TUG4 (fragment alt splicing??)


Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Rattus norvegicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AY387066
2 UniProt : Q63108, Q64646
1 Ncbi-nid : 1083619
3 UniProt : Q64646, Q63108, Q6TUG4
3 Interpro : Q64646, Q63108, Q6TUG4
3 Prodom : Q64646, Q63108, Q6TUG4
3 Pfam : Q64646, Q63108, Q6TUG4
3 PIRSF : Q64646, Q63108, Q6TUG4
3 SUPERFAM : Q64646, Q63108, Q6TUG4
Sequence
Graphical view for this peptide sequence: ratno-Ces1e
Colored MSA for Carb_B_Chordata (raw)
MCLYALILVFLAAFTAGGHPSSLPVVDTLQGKVLGKYVSLEGFTQPVAVF
LGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDPVAGQIVNDL
LTNWEENISLQFSEDCLYLNIYTPADLTKRDRLPVMVWIHGGGLVLGGAS
TYDGLALSTHENVVVVVIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHW
VQDNIDNFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLFHKAISESGVA
LTAGLVKKNTRPLAEKIAVVSGCKSTTSASMVHCLRQKTEEELLETTLKL
NLFSLDLHGDSRQSYPFVPTVLDGVVLPKMPEEILAEKDFNTVPYIVGIN
KQEFGWILPTMMNYPPSDMKLDPMTATSLLKKSSFLLNLPEEAIPVAVEK
YLRHTDDPDRNKDQLLELIGDVIFGVPSVIVSRGHRDAGARTYMYEFQYR
PSFSSKMKPSTVVGDHGDEIYSVFGAPILRGGTSKEEINLSKMMMKFWAN
FARNGNPNGQGLPHWPEYDQKEGYLQIGATTQQAQKLKEKEVAFWSELLA
MKPLHAGHTEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCLYALILVFLAAFTAGGHPSSLPVVDTLQGKVLGKYVSLEGFTQPVAVF
LGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDPVAGQIVNDL
LTNWEENISLQFSEDCLYLNIYTPADLTKRDRLPVMVWIHGGGLVLGGAS
TYDGLALSTHENVVVVVIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHW
VQDNIDNFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLFHKAISESGVA
LTAGLVKKNTRPLAEKIAVVSGCKSTTSASMVHCLRQKTEEELLETTLKL
NLFSLDLHGDSRQSYPFVPTVLDGVVLPKMPEEILAEKDFNTVPYIVGIN
KQEFGWILPTMMNYPPSDMKLDPMTATSLLKKSSFLLNLPEEAIPVAVEK
YLRHTDDPDRNKDQLLELIGDVIFGVPSVIVSRGHRDAGARTYMYEFQYR
PSFSSKMKPSTVVGDHGDEIYSVFGAPILRGGTSKEEINLSKMMMKFWAN
FARNGNPNGQGLPHWPEYDQKEGYLQIGATTQQAQKLKEKEVAFWSELLA
MKPLHAGHTEL


References
2 more
    Title: Cloning and sequencing of rat liver carboxylesterase ES-3 (egasyn)
    Robbi M, Beaufay H
    Ref: Biochemical & Biophysical Research Communications, 203 (3):1404, 1994 : PubMed

            

    Title: The carboxylesterase family exhibits C-terminal sequence diversity reflecting the presence or absence of endoplasmic-reticulum-retention sequences
    Medda S, Proia RL
    Ref: European Journal of Biochemistry, 206:801, 1992 : PubMed

            

    Title: An accessory protein identical to mouse egasyn is complexed with rat microsomal beta-glucuronidase and is identical to rat esterase-3
    Medda S, Takeuchi K, Devore-Carter D, von Deimling O, Heymann E, Swank RT
    Ref: Journal of Biological Chemistry, 262:7248, 1987 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer