Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aedae-ACHE

Aedes Aegypti mosquito acetylcholinesterase

Comment
Cterminus H peptide


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Aedes aegypti
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Culicomorpha: N E > Culicoidea: N E > Culicidae: N E > Culicinae: N E > Aedini: N E > Aedes: N E > Stegomyia: N E > Aedes aegypti: N E


Molecular evidence
Database
7 mutations: Table (e.g. : F105S/F350Y, F105S/G285A/F350Y, F105S/G285A ... more)
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : G1245693, CH899841
1 UniProt : J9I062
1 Ncbi-pid : 1245693
2 UniProt : Q9TX11, J9I062
2 Interpro : Q9TX11, J9I062
2 Prodom : Q9TX11, J9I062
2 Pfam : Q9TX11, J9I062
2 PIRSF : Q9TX11, J9I062
2 SUPERFAM : Q9TX11, J9I062
Sequence
Graphical view for this peptide sequence: aedae-ACHE
Colored MSA for ACHE (raw)
MKMSAVVRLCCNMISLLLCITVISPVYGIFDRLVVQTSSGPIRGRSTMVL
GREVHVFNGVPFAKPPVDGLRFRKPVPAEPWHGVLDATRLPPSCIQERYE
YFPGFAGEEMWNPNTNVSEDCLYLNIWVPTKTRLRHGRGLNFGNNDYFQD
DDDFQRQHQSKGGLAMLVWIYGGGFMSGTSTLDVYNAEMLAAVGNVIVAS
MQYRVGSFGFFYLAPYLNDDDAPGNVGLWDQALAIRWLKENAKAFGGDPD
LITLFGESAGGSSVSLHLLSPVTRGLSRRGILQSGTLNAPWSHMSAEKAL
SVAEALIDDCNCNVTLLKDNPNYVMNCMRNVDAKTISVQQWNSYSGILGF
PSAPTIDGVFMTADPMTMLREANLEGVEILVGSNRDEGTYFLLYDFIDYF
EKDAATSLPRDKFLEIMNTIFSKASEPEREAIIFQYTGWESGNDGYQNQQ
QVGRSVGDHFFICPTNEFALGLAERGASVYYYYFTHRTSTSLWGEWMGVL
HGDEVEYIFGQPMNVSMQYRQRERDLSRRMVLSVSEFARSGNPALEGEHW
PVYTKENPIYFIFNAEGEDDLRGEKYGRGPMATACAFWNDFLPRLRAWSV
PPKSSCNILEQTSAATILYVDIKIVTVLMVFILVRLY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKMSAVVRLCCNMISLLLCITVISPVYGIFDRLVVQTSSGPIRGRSTMVL
GREVHVFNGVPFAKPPVDGLRFRKPVPAEPWHGVLDATRLPPSCIQERYE
YFPGFAGEEMWNPNTNVSEDCLYLNIWVPTKTRLRHGRGLNFGNNDYFQD
DDDFQRQHQSKGGLAMLVWIYGGGFMSGTSTLDVYNAEMLAAVGNVIVAS
MQYRVGSFGFFYLAPYLNDDDAPGNVGLWDQALAIRWLKENAKAFGGDPD
LITLFGESAGGSSVSLHLLSPVTRGLSRRGILQSGTLNAPWSHMSAEKAL
SVAEALIDDCNCNVTLLKDNPNYVMNCMRNVDAKTISVQQWNSYSGILGF
PSAPTIDGVFMTADPMTMLREANLEGVEILVGSNRDEGTYFLLYDFIDYF
EKDAATSLPRDKFLEIMNTIFSKASEPEREAIIFQYTGWESGNDGYQNQQ
QVGRSVGDHFFICPTNEFALGLAERGASVYYYYFTHRTSTSLWGEWMGVL
HGDEVEYIFGQPMNVSMQYRQRERDLSRRMVLSVSEFARSGNPALEGEHW
PVYTKENPIYFIFNAEGEDDLRGEKYGRGPMATACAFWNDFLPRLRAWSV
PPKSSCNILEQTSAATILYVDIKIVTVLMVFILVRLY


References
    Title: Genome sequence of Aedes aegypti, a major arbovirus vector
    Nene V, Wortman JR, Lawson D, Haas B, Kodira C, Tu ZJ, Loftus B, Xi Z, Megy K and Severson DW <85 more author(s)>
    Ref: Science, 316:1718, 2007 : PubMed

            

    Title: Site-directed mutagenesis of an acetylcholinesterase gene from the yellow fever mosquito Aedes aegypti confers insecticide insensitivity
    Vaughan A, Rocheleau T, Ffrench-Constant R
    Ref: Experimental Parasitology, 87:237, 1997 : PubMed

            

    Title: Cloning, sequencing and functional expression of an acetylcholinesterase gene from the yellow fever mosquito Aedes aegypti
    Anthony N, Rocheleau T, Mocelin G, Lee HJ, Ffrench-Constant R
    Ref: FEBS Letters, 368:461, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer