Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: staau-SA0569

Staphylococcus aureus Alpha/beta hydrolase fold-containing protein

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Staphylococcus aureus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Staphylococcaceae: N E > Staphylococcus: N E > Staphylococcus aureus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: staau-SA0569
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MDLFTRKDGTSIHYSTLGEGYPIVLIHTVLDNYSVFNKLAAQLAKSFQVV
LIDLRGHGYSDKPRHIEIKDFSDDIVELLKYLYIEEVAFVCHEMGGIIGA
DISVRYPEFTSSLMLVNPTSIEGELPEERLFRKYAHIIRNWDPEKQDKFL
NKRKYYRPRKMNRFLKHVVDTNEISTKEEIQAVKEVFKNADISQTYRNVV
VPTKIIAGEFGERTTRLEAKEVADLIQNADFEVYQESSAFPFVEEQERFV
EDIASFINKHHDEKHV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDLFTRKDGTSIHYSTLGEGYPIVLIHTVLDNYSVFNKLAAQLAKSFQVV
LIDLRGHGYSDKPRHIEIKDFSDDIVELLKYLYIEEVAFVCHEMGGIIGA
DISVRYPEFTSSLMLVNPTSIEGELPEERLFRKYAHIIRNWDPEKQDKFL
NKRKYYRPRKMNRFLKHVVDTNEISTKEEIQAVKEVFKNADISQTYRNVV
VPTKIIAGEFGERTTRLEAKEVADLIQNADFEVYQESSAFPFVEEQERFV
EDIASFINKHHDEKHV


References
12 more
    Title: Complete genome sequence of Staphylococcus aureus strain JKD6159, a unique Australian clone of ST93-IV community methicillin-resistant Staphylococcus aureus
    Chua K, Seemann T, Harrison PF, Davies JK, Coutts SJ, Chen H, Haring V, Moore R, Howden BP, Stinear TP
    Ref: Journal of Bacteriology, 192:5556, 2010 : PubMed

            

    Title: Genome sequence of a recently emerged, highly transmissible, multi-antibiotic- and antiseptic-resistant variant of methicillin-resistant Staphylococcus aureus, sequence type 239 (TW)
    Holden MT, Lindsay JA, Corton C, Quail MA, Cockfield JD, Pathak S, Batra R, Parkhill J, Bentley SD, Edgeworth JD
    Ref: Journal of Bacteriology, 192:888, 2010 : PubMed

            

    Title: Recent human-to-poultry host jump, adaptation, and pandemic spread of Staphylococcus aureus
    Lowder BV, Guinane CM, Ben Zakour NL, Weinert LA, Conway-Morris A, Cartwright RA, Simpson AJ, Rambaut A, Nubel U, Fitzgerald JR
    Ref: Proc Natl Acad Sci U S A, 106:19545, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer