Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: anoga-q7q887

Anopheles gambiae (African malaria mosquito); Anopheles arabiensis; A. sinensis; A. funestus; A. coluzzii; A. melas; A. stephensi (Indo-Pakistan malaria mosquito); A. minimus; A. farauti; A. culicifacies; A. albimanus (New world malaria mosquito); A. merus; A. dirus; A. epiroticus; A. darlingi; A. atroparvus; A. quadriannulatus. Protein bem46

Comment
Other strains: Anopheles gambiae (African malaria mosquito); Anopheles arabiensis; Anopheles sinensis; Anopheles funestus (African malaria mosquito); Anopheles coluzzii; Anopheles melas; Anopheles stephensi (Indo-Pakistan malaria mosquito); Anopheles minimus; Anopheles farauti; Anopheles culicifacies; Anopheles albimanus (New world malaria mosquito); Anopheles merus; Anopheles dirus; Anopheles epiroticus; Anopheles darlingi; Anopheles atroparvus; Anopheles quadriannulatus


Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Anopheles gambiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Culicomorpha: N E > Culicoidea: N E > Culicidae: N E > Anophelinae: N E > Anopheles [genus]: N E > Cellia: N E > Pyretophorus: N E > gambiae species complex: N E > Anopheles gambiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 5 more: AAAB01008944, XP_314863.4, APCN01000649
>3 UniProt links 13 more: Q7Q887, A0A182IB88, A0A084VMN1
>3 UniProt links 13 more: Q7Q887, A0A182IB88, A0A084VMN1
>3 Interpro links 13 more: Q7Q887, A0A182IB88, A0A084VMN1
>3 Prodom links 13 more: Q7Q887, A0A182IB88, A0A084VMN1
>3 Pfam links 13 more: Q7Q887, A0A182IB88, A0A084VMN1
>3 PIRSF links 13 more: Q7Q887, A0A182IB88, A0A084VMN1
>3 SUPERFAM links 13 more: Q7Q887, A0A182IB88, A0A084VMN1
Sequence
Graphical view for this peptide sequence: anoga-q7q887
Colored MSA for ABHD13-BEM46 (raw)
MSFRDWKIVRVLAGIAMRIWAASGAALLSAFLIYVVYGGFFAFLLLLFAI
SGILYHAQDNLLYHPELPANSRIFIPVPSMHGLPYETLHLKTRDAVSLHA
FWIRHPGDKGRYVPTIVYFHGNAGNMGHRLQNATGFYHTLQCNVLMVEYR
GYGLSTGTPSEKGFFADARSVLDHLFSRHDLDHGQIVVFGRSLGGAVSID
LAADAVYGAKLMGVIVENTFTSIPDMAVELIHPAVQYLPLVLYRNQYLSV
DKIQFVSAPILFVSGLADTLVPPRMMTMLHTRCGSTRKQMLQIVGGSHND
TWAVNGYYQGVAQFLKECRETKGPLQTPPVSHNVWPNIEEV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSFRDWKIVRVLAGIAMRIWAASGAALLSAFLIYVVYGGFFAFLLLLFAI
SGILYHAQDNLLYHPELPANSRIFIPVPSMHGLPYETLHLKTRDAVSLHA
FWIRHPGDKGRYVPTIVYFHGNAGNMGHRLQNATGFYHTLQCNVLMVEYR
GYGLSTGTPSEKGFFADARSVLDHLFSRHDLDHGQIVVFGRSLGGAVSID
LAADAVYGAKLMGVIVENTFTSIPDMAVELIHPAVQYLPLVLYRNQYLSV
DKIQFVSAPILFVSGLADTLVPPRMMTMLHTRCGSTRKQMLQIVGGSHND
TWAVNGYYQGVAQFLKECRETKGPLQTPPVSHNVWPNIEEV


References
5 more
    Title: Update of the Anopheles gambiae PEST genome assembly
    Sharakhova MV, Hammond MP, Lobo NF, Krzywinski J, Unger MF, Hillenmeyer ME, Bruggner RV, Birney E, Collins FH
    Ref: Genome Biol, 8:R5, 2007 : PubMed

            

    Title: The Anopheles gambiae genome: an update
    Mongin E, Louis C, Holt RA, Birney E, Collins FH
    Ref: Trends Parasitol, 20:49, 2004 : PubMed

            

    Title: The genome sequence of the malaria mosquito Anopheles gambiae
    Holt RA, Subramanian GM, Halpern A, Sutton GG, Charlab R, Nusskern DR, Wincker P, Clark AG, Ribeiro JM and Hoffman SL <113 more author(s)>
    Ref: Science, 298:129, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer