arath-AT4G00500

 
Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) F6N23.21 AT4G00500 lipase protein

Comment
Q8W495 slightly different O65259


Relationship
Family Lipase_3
Block L
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : AF058919, AL161472
3 UniProt : D7M5N3, Q8W495, O65259
3 UniProtTrembl : D7M5N3, Q8W495, O65259
3 Interpro : D7M5N3, Q8W495, O65259
3 Prodom : D7M5N3, Q8W495, O65259
3 Pfam : D7M5N3, Q8W495, O65259
3 PIRSF : D7M5N3, Q8W495, O65259
3 SUPERFAM : D7M5N3, Q8W495, O65259
3 QuickSwissBlast : D7M5N3, Q8W495, O65259
1 Tair database : AT4G00500
 
Sequence
Graphical view for this peptide sequence: arath-AT4G00500
Colored MSA for Lipase_3 (raw)
MSILCCVPVLECVYCLGCTHWLWKKCLYSAGHESENWGLATSDEFEPIPR
ICRLILAVYEENLHDPMWAPPDGYGIDPNHVILKKDYDQTEGRVTPYMIY
LDHENGDVVLAIRGLNLAKECDYAVLLDNKLGQTKFDGGYVHNGLLKAAM
WVFEEEHVVLRELLEANPSYSLTFVGHSLGAGVVSLLVLFVIQNRVRLGN
IERKRIRCFAIAPPRCMSLHLAVTYADVINSVVLQDDFLPRTTTALENVF
KSIICLPCLLCLTCLKDTFTFEERKLKDARRLYAPGRLYHIVVRKPLRLG
RYPPVVRTAVPVDGRFEQIVLSCNATADHAIIWIERESQRALD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSILCCVPVLECVYCLGCTHWLWKKCLYSAGHESENWGLATSDEFEPIPR
ICRLILAVYEENLHDPMWAPPDGYGIDPNHVILKKDYDQTEGRVTPYMIY
LDHENGDVVLAIRGLNLAKECDYAVLLDNKLGQTKFDGGYVHNGLLKAAM
WVFEEEHVVLRELLEANPSYSLTFVGHSLGAGVVSLLVLFVIQNRVRLGN
IERKRIRCFAIAPPRCMSLHLAVTYADVINSVVLQDDFLPRTTTALENVF
KSIICLPCLLCLTCLKDTFTFEERKLKDARRLYAPGRLYHIVVRKPLRLG
RYPPVVRTAVPVDGRFEQIVLSCNATADHAIIWIERESQRALD

no DNA




References
    Title: The Arabidopsis lyrata genome sequence and the basis of rapid genome size change
    Hu TT, Pattyn P, Bakker EG, Cao J, Cheng JF, Clark RM, Fahlgren N, Fawcett JA, Grimwood J and Guo YL <20 more author(s)>
    Ref: Nat Genet, 43:476, 2011 : PubMed

            

    Title: Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana
    Mayer K, Schuller C, Wambutt R, Murphy G, Volckaert G, Pohl T, Dusterhoft A, Stiekema W, Entian KD and McCombie WR <220 more author(s)>
    Ref: Nature, 402:769, 1999 : PubMed

            

    Title: Analysis of 1.9 Mb of contiguous sequence from chromosome 4 of Arabidopsis thaliana.
    Bevan M, Bancroft I, Bent E, Love K, Goodman H, Dean C, Bergkamp R, Dirkse W, van Staveren M and Chalwatzis N <58 more author(s)>
    Ref: Nature, 391:485, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer