arath-AT5G20520

 
Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) ABAPT11 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase WAV2, WAVY GROWTH 2, Bem46-like protein

Comment
The Arabidopsis WAVY GROWTH 2 Protein Modulates Root Bending in Response to Environmental Stimuli. Other strains: Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)


Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 7 more: AY080751, AY114009, AY087569
2 UniProt : Q8RXP6, D7M018
1 Ncbi-nid : 57157670
1 Ncbi-pid : 57157671
2 UniProtTrembl : Q8RXP6, D7M018
2 Interpro : Q8RXP6, D7M018
2 Prodom : Q8RXP6, D7M018
2 Pfam : Q8RXP6, D7M018
2 PIRSF : Q8RXP6, D7M018
2 SUPERFAM : Q8RXP6, D7M018
2 QuickSwissBlast : Q8RXP6, D7M018
1 Tair database : AT5G20520
 
Sequence
Graphical view for this peptide sequence: arath-AT5G20520
Colored MSA for ABHD13-BEM46 (raw)
MVTYVSALFYGFGGIVVAGVALLVAFQEKLVYVPVLPGLSKSYPITPARL
NLIYEDIWLQSSDGVRLHAWFIKMFPECRGPTILFFQENAGNIAHRLEMV
RIMIQKLKCNVFMLSYRGYGASEGYPSQQGIIKDAQAALDHLSGRTDIDT
SRIVVFGRSLGGAVGAVLTKNNPDKVSALILENTFTSILDMAGVLLPFLK
WFIGGSGTKSLKLLNFVVRSPWKTIDAIAEIKQPVLFLSGLQDEMVPPFH
MKMLYAKAAARNPQCTFVEFPSGMHMDTWLSGGEVYWKTNLQFLEKYAPE
KRKEDTGR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVTYVSALFYGFGGIVVAGVALLVAFQEKLVYVPVLPGLSKSYPITPARL
NLIYEDIWLQSSDGVRLHAWFIKMFPECRGPTILFFQENAGNIAHRLEMV
RIMIQKLKCNVFMLSYRGYGASEGYPSQQGIIKDAQAALDHLSGRTDIDT
SRIVVFGRSLGGAVGAVLTKNNPDKVSALILENTFTSILDMAGVLLPFLK
WFIGGSGTKSLKLLNFVVRSPWKTIDAIAEIKQPVLFLSGLQDEMVPPFH
MKMLYAKAAARNPQCTFVEFPSGMHMDTWLSGGEVYWKTNLQFLEKYAPE
KRKEDTGR

no DNA




References
5 more
    Title: An ABHD17-like hydrolase screening system to identify de-S-acylation enzymes of protein substrates in plant cells
    Liu X, Li M, Li Y, Chen Z, Zhuge C, Ouyang Y, Zhao Y, Lin Y, Xie Q and Lai J <1 more author(s)>
    Ref: Plant Cell, :, 2021 : PubMed

            

    Title: The Arabidopsis WAVY GROWTH 2 protein modulates root bending in response to environmental stimuli
    Mochizuki S, Harada A, Inada S, Sugimoto-Shirasu K, Stacey N, Wada T, Ishiguro S, Okada K, Sakai T
    Ref: Plant Cell, 17:537, 2005 : PubMed

            

    Title: Full-length messenger RNA sequences greatly improve genome annotation
    Haas BJ, Volfovsky N, Town CD, Troukhan M, Alexandrov N, Feldmann KA, Flavell RB, White O, Salzberg SL
    Ref: Genome Biol, 3:RESEARCH0029, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer