Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-AT5G20520

Arabidopsis thaliana (Mouse-ear cress); Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) ABAPT11 (Alpha/Beta Hydrolase Domain-containing Protein 17)-like Acyl Protein Thioesterase WAV2, WAVY GROWTH 2, Bem46-like protein

Comment
The Arabidopsis WAVY GROWTH 2 Protein Modulates Root Bending in Response to Environmental Stimuli. Other strains: Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress). arath-AT5G20520 ABAPT11 expression is quickly induced by defense hormone salicylic acid (SA). arath-AT5G20520 ABAPT11 de-S-acylates Brassinosteroid signaling kinases (BSKs) which then are not associated to the membrane and have reduced activity.


Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: arath-AT5G20520
Colored MSA for ABHD13-BEM46 (raw)
MVTYVSALFYGFGGIVVAGVALLVAFQEKLVYVPVLPGLSKSYPITPARL
NLIYEDIWLQSSDGVRLHAWFIKMFPECRGPTILFFQENAGNIAHRLEMV
RIMIQKLKCNVFMLSYRGYGASEGYPSQQGIIKDAQAALDHLSGRTDIDT
SRIVVFGRSLGGAVGAVLTKNNPDKVSALILENTFTSILDMAGVLLPFLK
WFIGGSGTKSLKLLNFVVRSPWKTIDAIAEIKQPVLFLSGLQDEMVPPFH
MKMLYAKAAARNPQCTFVEFPSGMHMDTWLSGGEVYWKTNLQFLEKYAPE
KRKEDTGR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVTYVSALFYGFGGIVVAGVALLVAFQEKLVYVPVLPGLSKSYPITPARL
NLIYEDIWLQSSDGVRLHAWFIKMFPECRGPTILFFQENAGNIAHRLEMV
RIMIQKLKCNVFMLSYRGYGASEGYPSQQGIIKDAQAALDHLSGRTDIDT
SRIVVFGRSLGGAVGAVLTKNNPDKVSALILENTFTSILDMAGVLLPFLK
WFIGGSGTKSLKLLNFVVRSPWKTIDAIAEIKQPVLFLSGLQDEMVPPFH
MKMLYAKAAARNPQCTFVEFPSGMHMDTWLSGGEVYWKTNLQFLEKYAPE
KRKEDTGR


References
6 more
    Title: Salicylic acid attenuates brassinosteroid signaling via protein de-S-acylation
    Liu X, Chen Z, Huang L, Ouyang Y, Wang Z, Wu S, Ye W, Yu B, Zhang Y and Lai J <1 more author(s)>
    Ref: EMBO j, :e112998, 2023 : PubMed

            

    Title: An ABHD17-like hydrolase screening system to identify de-S-acylation enzymes of protein substrates in plant cells
    Liu X, Li M, Li Y, Chen Z, Zhuge C, Ouyang Y, Zhao Y, Lin Y, Xie Q and Lai J <1 more author(s)>
    Ref: Plant Cell, :, 2021 : PubMed

            

    Title: The Arabidopsis WAVY GROWTH 2 protein modulates root bending in response to environmental stimuli
    Mochizuki S, Harada A, Inada S, Sugimoto-Shirasu K, Stacey N, Wada T, Ishiguro S, Okada K, Sakai T
    Ref: Plant Cell, 17:537, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer