Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacan-BA0954

Bacillus anthracis, Bacillus thuringiensis, Lysinibacillus sphaericus, Bacillus cereus; Bacillus mycoides, Bacillus weihenstephanensis, Bifunctional nucleotide sugar epimerase/hydrolase mxaa domain protein

Comment
Other strains: Bacillus anthracis (strains Ames; CDC 684 / NRRL 3495; A0193; Tsiankovskii-I; A0174; A0488; A0389; A0248) Bacillus thuringiensis (strains IBL 200; Bt407; IBL 4222; (serovars israelensis ATCC 35646; berliner ATCC 10792; thuringiensis T01001; tochigiensis BGSC 4Y1 ) Lysinibacillus sphaericus (strain C3-41) Bacillus cereus (strain G9842; H3081.97; BDRD-ST26; AH187; MM3; R309803; AH621; ZK / E33L; ATCC 10876; m1293; m1550; BDRD-ST196; Rock1-3; Rock3-29; BDRD-ST24; AH1271; Rock4-18; Q1; Rock3-28; Rock4-2; F65185; ATCC 4342) Bacillus mycoides DSM 2048 Bacillus weihenstephanensis (strain KBAB4) Only C-term half homologous to AlphaBeta_hydrolase


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Bacillus anthracis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus anthracis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 37 more: ACNK01000067, AE017027, CP000817
>3 UniProt links 16 more: B1HND2, Q3ES84, B7ING1
>3 UniProt links 17 more: Q81UC4, B1HND2, Q3ES84
>3 Interpro links 17 more: Q81UC4, B1HND2, Q3ES84
>3 Prodom links 17 more: Q81UC4, B1HND2, Q3ES84
>3 Pfam links 17 more: Q81UC4, B1HND2, Q3ES84
>3 PIRSF links 17 more: Q81UC4, B1HND2, Q3ES84
>3 SUPERFAM links 17 more: Q81UC4, B1HND2, Q3ES84
Sequence
Graphical view for this peptide sequence: bacan-BA0954
Colored MSA for 6_AlphaBeta_hydrolase (raw)
EDLFPLAQELHEKTGQPVWILDLPGLGRSPFKREKNLLDIYLNVVKRLLE
KATNGAHLIGHSFGAFILLEALVQEYIDKKYSITLLQPPVAKKNAKSLNV
PQFMNKWTLKLATTNLIGRYLLSNGLFESMESIPEHYIEKISNSFTSPRI
LNTTVQLNSLLLKNDQGDFNEVTKYNLHIIWGDYDRAYSAPSHLGKVDFV
PYGHHFPLSHPSETATLVIKNSNTSRWECGINKSV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

EDLFPLAQELHEKTGQPVWILDLPGLGRSPFKREKNLLDIYLNVVKRLLE
KATNGAHLIGHSFGAFILLEALVQEYIDKKYSITLLQPPVAKKNAKSLNV
PQFMNKWTLKLATTNLIGRYLLSNGLFESMESIPEHYIEKISNSFTSPRI
LNTTVQLNSLLLKNDQGDFNEVTKYNLHIIWGDYDRAYSAPSHLGKVDFV
PYGHHFPLSHPSETATLVIKNSNTSRWECGINKSV


References
2 more
    Title: Complete genome sequence of the mosquitocidal bacterium Bacillus sphaericus C3-41 and comparison with those of closely related Bacillus species
    Hu X, Fan W, Han B, Liu H, Zheng D, Li Q, Dong W, Yan J, Gao M and Yuan Z <1 more author(s)>
    Ref: Journal of Bacteriology, 190:2892, 2008 : PubMed

            

    Title: Pathogenomic sequence analysis of Bacillus cereus and Bacillus thuringiensis isolates closely related to Bacillus anthracis
    Han CS, Xie G, Challacombe JF, Altherr MR, Bhotika SS, Brown N, Bruce D, Campbell CS, Campbell ML and Gilna P <38 more author(s)>
    Ref: Journal of Bacteriology, 188:3382, 2006 : PubMed

            

    Title: The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria
    Read TD, Peterson SN, Tourasse N, Baillie LW, Paulsen IT, Nelson KE, Tettelin H, Fouts DE, Eisen JA and Fraser CM <42 more author(s)>
    Ref: Nature, 423:81, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer