mouse-3neur

 
Mus musculus (Mouse) partial mRNA for neuroligin 3 protein

Comment
on chromosome X ENSMUSG00000031302 Q8BYM5 from Okazaki some diff


Relationship
Family Neuroligin
Block C
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
2 mutations: Table (ordered Natural and SD mutagenesis)KO/deltot_mouse-3neur, R451C
2 structures: 7CEG, 7CEE
No kinetic



>3 Genbank links 4 more: AJ291730, NM_172932, AK039018
>3 UniProt links 4 more: Q8BYM5, Q69ZI4, A2AGI0
1 Ncbi-nid : 13928057
1 Ncbi-pid : 13928058
2 Structure : 7CEG, 7CEE
>3 UniProtTrembl links 4 more: Q924X0, Q8BYM5, Q69ZI4
>3 Interpro links 4 more: Q924X0, Q8BYM5, Q69ZI4
>3 Prodom links 4 more: Q924X0, Q8BYM5, Q69ZI4
>3 Pfam links 4 more: Q924X0, Q8BYM5, Q69ZI4
>3 PIRSF links 4 more: Q924X0, Q8BYM5, Q69ZI4
>3 SUPERFAM links 4 more: Q924X0, Q8BYM5, Q69ZI4
>3 QuickSwissBlast links 4 more: Q924X0, Q8BYM5, Q69ZI4
1 MGD : 2444609
1 ENSEMBL : ENSMUSG00000031302
 
Sequence
Graphical view for this peptide sequence: mouse-3neur
Colored MSA for Neuroligin (raw)
GSSQCGHEGAAYWADAVTPESSSPASPPARNMWLQPSLSLSPTPTVGRSL
CLTLGFLSLVLRASTQAPAPTVNTHFGKLRGARVPLPSEILGPVDQYLGV
PYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVW
FTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICRKG
GSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGS
VLASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENI
AFFGGDPRRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWA
VNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKELVEQDIQPARYHV
AFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDPED
GVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPETRRK
TLVALFTDHQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDAA
HGDEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNK
PVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGLKPRVRDHYRATKVA
FWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITRRPNGKTWSTKRP
AISPAYSNENAPGSWNGDQDAGPLLVENPRDYSTELSVTIAVGASLLFLN
VLAFAALYYRKDKRRQEPLRQPSPQRGTGAPELGTAPEEELAALQLGPTH
HECEAGPPHDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQ
TLHPYNTFAAGFNSTGLPHSHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GSSQCGHEGAAYWADAVTPESSSPASPPARNMWLQPSLSLSPTPTVGRSL
CLTLGFLSLVLRASTQAPAPTVNTHFGKLRGARVPLPSEILGPVDQYLGV
PYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVW
FTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICRKG
GSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGS
VLASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENI
AFFGGDPRRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSSWA
VNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKELVEQDIQPARYHV
AFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDPED
GVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPETRRK
TLVALFTDHQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDAA
HGDEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNK
PVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGLKPRVRDHYRATKVA
FWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITRRPNGKTWSTKRP
AISPAYSNENAPGSWNGDQDAGPLLVENPRDYSTELSVTIAVGASLLFLN
VLAFAALYYRKDKRRQEPLRQPSPQRGTGAPELGTAPEEELAALQLGPTH
HECEAGPPHDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQ
TLHPYNTFAAGFNSTGLPHSHSTTRV

Graphical view for this nucleotide DNA sequence (458 bp): mouse-3neur



References
10 more
    Title: Autism-related neuroligin-3 mutation alters social behavior and spatial learning
    Jaramillo TC, Liu S, Pettersen A, Birnbaum SG, Powell CM
    Ref: Autism Res, 7:264, 2014 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            

    Title: Neuroligin 3 is a vertebrate gliotactin expressed in the olfactory ensheathing glia, a growth-promoting class of macroglia
    Gilbert M, Smith J, Roskams AJ, Auld VJ
    Ref: Glia, 34:151, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer