mouse-SPG21

 
Mus musculus (Mouse) hypothetical Maspardin-ACP33-SPG21 Spg21 Spastic paraplegia 21 homolog (Human)

Comment
Mus musculus (Mouse) dna segment, chr 9, wayne state university 18, expressed, Q8C1Y7 and Q9CQC8 differ at the C-term end IHLLQFHGTKYAAIDPSVVSAEELEVQKGRLGLSQEEP replaced by VSPAWTPEHVRFRDPPQDSAP


Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 10 more: BC132377, BC132403, CH466522
2 UniProt : A2RT57, Q9CQC8
2 UniProtTrembl : A2RT57, Q9CQC8
2 Interpro : A2RT57, Q9CQC8
2 Prodom : A2RT57, Q9CQC8
2 Pfam : A2RT57, Q9CQC8
2 PIRSF : A2RT57, Q9CQC8
2 SUPERFAM : A2RT57, Q9CQC8
2 QuickSwissBlast : A2RT57, Q9CQC8
1 MGD : 106403
1 ENSEMBL : ENSMUSG00000034955
 
Sequence
Graphical view for this peptide sequence: mouse-SPG21
Colored MSA for Maspardin-ACP33-SPG21_like (raw)
MGEIKVSPDYNWFRSTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLP
PVSGTADVFFQQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQL
DKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNAFSDTSIFNQTWTAN
SFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRL
TLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHL
KTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSVVSAEELEVQKGR
LGLSQEEP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGEIKVSPDYNWFRSTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLP
PVSGTADVFFQQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQL
DKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNAFSDTSIFNQTWTAN
SFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRL
TLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHL
KTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSVVSAEELEVQKGR
LGLSQEEP

no DNA




References
2 more
    Title: A comparison of whole-genome shotgun-derived mouse chromosome 16 and the human genome
    Mural RJ, Adams MD, Myers EW, Smith HO, Miklos GL, Wides R, Halpern A, Li PW, Sutton GG and Stephenson LD <169 more author(s)>
    Ref: Science, 296:1661, 2002 : PubMed

            

    Title: Functional annotation of a full-length mouse cDNA collection
    Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y and Hayashizaki Y <86 more author(s)>
    Ref: Nature, 409:685, 2001 : PubMed

            

    Title: Cloning of ACP33 as a novel intracellular ligand of CD4
    Zeitlmann L, Sirim P, Kremmer E, Kolanus W
    Ref: Journal of Biological Chemistry, 276:9123, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer