Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspna-g3y5a6

Aspergillus niger; Aspergillus brasiliensis; A. neoniger; A. kawachii; A. luchuensis; A. vadensis; A. tubingensis; A. eucalypticola; A. welwitschiae; A. phoenicis; A. lacticoffeatus; A. luchuensis; A. awamori. Histone deacetylase Arb2 domain

Comment
Other strains: Aspergillus niger (ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7; ATCC 13496; CBS 513.88 / FGSC A1513); Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946); Aspergillus neoniger (strain CBS 115656); Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi; Aspergillus luchuensis (strain CBS 106.47); Aspergillus vadensis (strain CBS 113365 / IMI 142717 / IBT 24658); Aspergillus tubingensis (strain CBS 134.48); Aspergillus eucalypticola (strain CBS 122712 / IBT 29274); Aspergillus welwitschiae; Aspergillus phoenicis ATCC 13157; Aspergillus lacticoffeatus (strain CBS 101883); Aspergillus luchuensis; Aspergillus awamori (Black koji mold)


Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Aspergillus niger
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus niger: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 12 more: ACJE01000013, KV878684, KZ821469
>3 UniProt links 12 more: G3Y5A6, A0A1L9UK92, A0A318Z5D8
>3 UniProt links 14 more: G3Y5A6, A0A1L9UK92, A0A318Z5D8
>3 Interpro links 14 more: G3Y5A6, A0A1L9UK92, A0A318Z5D8
>3 Pfam links 14 more: G3Y5A6, A0A1L9UK92, A0A318Z5D8
>3 PIRSF links 14 more: G3Y5A6, A0A1L9UK92, A0A318Z5D8
>3 SUPERFAM links 14 more: G3Y5A6, A0A1L9UK92, A0A318Z5D8
Sequence
Graphical view for this peptide sequence: aspna-g3y5a6
Colored MSA for Arb2_domain (raw)
RLHDVIRAYQSKQLYDNYKLTSLFIYRTAISRSFENQVLASSNYHQAVPL
VVIFHDPPEIMGLPHPVTNKLEAHNCWLADVMKDYIGWIVSKGYAVIDVN
IPKHVTIDPSSGKYEEEDENRPTATEELAGYLWDNYIEPSEATEIFFMGV
GNAFYGVANLLINRETLYKRVNSVVSFVAENPVRAIASHTQVWLSRWYKD
NSLVFVSHTHGVWNNVETRRKPSKRYGQLVQSPKASLSEMLMHHKEEVYQ
WISERADVQDSEETEDEKKPKSKSRSPTKENQTEPRSVPG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RLHDVIRAYQSKQLYDNYKLTSLFIYRTAISRSFENQVLASSNYHQAVPL
VVIFHDPPEIMGLPHPVTNKLEAHNCWLADVMKDYIGWIVSKGYAVIDVN
IPKHVTIDPSSGKYEEEDENRPTATEELAGYLWDNYIEPSEATEIFFMGV
GNAFYGVANLLINRETLYKRVNSVVSFVAENPVRAIASHTQVWLSRWYKD
NSLVFVSHTHGVWNNVETRRKPSKRYGQLVQSPKASLSEMLMHHKEEVYQ
WISERADVQDSEETEDEKKPKSKSRSPTKENQTEPRSVPG


References
3 more
    Title: Comparative genomics reveals high biological diversity and specific adaptations in the industrially and medically important fungal genus Aspergillus
    de Vries RP, Riley R, Wiebenga A, Aguilar-Osorio G, Amillis S, Uchima CA, Anderluh G, Asadollahi M, Askin M and Grigoriev IV <107 more author(s)>
    Ref: Genome Biol, 18:28, 2017 : PubMed

            

    Title: Comparative genomics of citric-acid-producing Aspergillus niger ATCC 1015 versus enzyme-producing CBS 513.88
    Andersen MR, Salazar MP, Schaap PJ, van de Vondervoort PJ, Culley D, Thykaer J, Frisvad JC, Nielsen KF, Albang R and Baker SE <37 more author(s)>
    Ref: Genome Res, 21:885, 2011 : PubMed

            

    Title: Genome sequence of the white koji mold Aspergillus kawachii IFO 4308, used for brewing the Japanese distilled spirit shochu
    Futagami T, Mori K, Yamashita A, Wada S, Kajiwara Y, Takashita H, Omori T, Takegawa K, Tashiro K and Goto M <1 more author(s)>
    Ref: Eukaryot Cell, 10:1586, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer