human-ACOT1

 
Homo sapiens (Human) Inducible cytosolic acyl-coenzyme A thioester hydrolase Long chain Acyl-CoA hydrolase) (cte-i) (cte-ib)

Comment
The mouse ACOT gene cluster comprises six genes with localizations in cytosol (ACOT1), mitochondria (ACOT2), and peroxisomes (ACOT3-6). The corresponding human gene cluster contains only three genes (ACOT1, ACOT2, and ACOT4) coding for full-length thioesterase proteins only ACOT4 is peroxisomal


Relationship
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic


Inhibitor: Rocaglate-Derived-beta-Lactone-5 ,
>3 Genbank links 3 more: BX161396, DQ082754, BC144425
>3 UniProt links 2 more: Q86TX2, B7ZMC1, A1L172
>3 UniProtTrembl links 2 more: Q86TX2, B7ZMC1, A1L172
>3 Interpro links 2 more: Q86TX2, B7ZMC1, A1L172
>3 Prodom links 2 more: Q86TX2, B7ZMC1, A1L172
>3 Pfam links 2 more: Q86TX2, B7ZMC1, A1L172
>3 PIRSF links 2 more: Q86TX2, B7ZMC1, A1L172
>3 SUPERFAM links 2 more: Q86TX2, B7ZMC1, A1L172
>3 QuickSwissBlast links 2 more: Q86TX2, B7ZMC1, A1L172
1 EntrezGene : 641371
1 SNP : 641371
1 UniGene : 446685
1 HUGO HGNC : 33128
1 OMIM : 614313
1 Ensembl : ENSG00000184227
 
Sequence
Graphical view for this peptide sequence: human-ACOT1
Colored MSA for Acyl-CoA_Thioesterase (raw)
MAATLILEPAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHA
RYRADTLGELDLERAPALGGSFAGLEPMGLLWALEPEKPLVRLVKRDVRT
PLAVELEVLDGHDPDPGRLLCRVRHERYFLPPGVRREPVRAGRVRGTLFL
PPEPGPFPGIVDMFGTGGGLLEYRASLLAGKGFAVMALAYYNYEDLPKTM
ETLHLEYFEEAVNYLLSHPEVKGPGVGLLGISKGGELCLSMASFLKGITA
AVVINGSVANVGGTLRYKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPL
EGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKP
QIICYPETGHYIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWK
QLQTFFHKHLGGHEGTIPSKV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAATLILEPAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHA
RYRADTLGELDLERAPALGGSFAGLEPMGLLWALEPEKPLVRLVKRDVRT
PLAVELEVLDGHDPDPGRLLCRVRHERYFLPPGVRREPVRAGRVRGTLFL
PPEPGPFPGIVDMFGTGGGLLEYRASLLAGKGFAVMALAYYNYEDLPKTM
ETLHLEYFEEAVNYLLSHPEVKGPGVGLLGISKGGELCLSMASFLKGITA
AVVINGSVANVGGTLRYKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPL
EGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKP
QIICYPETGHYIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWK
QLQTFFHKHLGGHEGTIPSKV

no DNA




References
    Title: Remodeling natural products: chemistry and serine hydrolase activity of a rocaglate-derived beta-lactone
    Lajkiewicz NJ, Cognetta AB, 3rd, Niphakis MJ, Cravatt BF, Porco JA, Jr.
    Ref: Journal of the American Chemical Society, 136:2659, 2014 : PubMed

            

    Title: Analysis of the mouse and human acyl-CoA thioesterase (ACOT) gene clusters shows that convergent, functional evolution results in a reduced number of human peroxisomal ACOTs
    Hunt MC, Rautanen A, Westin MA, Svensson LT, Alexson SE
    Ref: FASEB Journal, 20:1855, 2006 : PubMed

            

    Title: Complete sequencing and characterization of 21,243 full-length human cDNAs
    Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H and Sugano S <144 more author(s)>
    Ref: Nat Genet, 36:40, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer