myctu-bpoC

 
Mycobacterium tuberculosis, Mycobacterium bovis, Rv0554 MT0580 bpoC bromoperoxidase, putative

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
5 structures (e.g. : 7LD8, 3HSS, 3HYS... more)
No kinetic



>3 Genbank links 33 more: Z95558, BX248335, BX842573
>3 UniProt links 6 more: P9WNH1, P9WNH0, A1KG31
1 Ncbi-nid : 3261781
1 Ncbi-pid : 2114016
>3 Structure links 2 more: 7LD8, 3HSS, 3HYS
3 UniProtTrembl : P9WNH1, P9WNH0, A5TZT4
3 Interpro : P9WNH1, P9WNH0, A5TZT4
3 Prodom : P9WNH1, P9WNH0, A5TZT4
3 Pfam : P9WNH1, P9WNH0, A5TZT4
3 PIRSF : P9WNH1, P9WNH0, A5TZT4
3 SUPERFAM : P9WNH1, P9WNH0, A5TZT4
3 QuickSwissBlast : P9WNH1, P9WNH0, A5TZT4
 
Sequence
Graphical view for this peptide sequence: myctu-bpoC
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCITFDNRG
IGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVA
PELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLEN
FSRKTLNDDVAVGDWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIA
APVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDAGHLGFFERPEAVN
TAMLKFFASVKA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCITFDNRG
IGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVA
PELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLEN
FSRKTLNDDVAVGDWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIA
APVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDAGHLGFFERPEAVN
TAMLKFFASVKA

Graphical view for this nucleotide DNA sequence (817 bp): myctu-bpoC



References
4 more
    Title: The alpha/beta Hydrolase Fold Proteins of Mycobacterium tuberculosis, With Reference to their Contribution to Virulence
    Johnson G
    Ref: Curr Protein Pept Sci, 18:190, 2016 : PubMed

            

    Title: Structural and functional analysis of Rv0554 from Mycobacterium tuberculosis: testing a putative role in menaquinone biosynthesis
    Johnston JM, Jiang M, Guo Z, Baker EN
    Ref: Acta Crystallographica D Biol Crystallogr, 66:909, 2010 : PubMed

            

    Title: Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains
    Fleischmann RD, Alland D, Eisen JA, Carpenter L, White O, Peterson J, Deboy R, Dodson R, Gwinn M and Fraser CM <16 more author(s)>
    Ref: Journal of Bacteriology, 184:5479, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer