myctu-ym24

Mycobacterium tuberculosis, Mycobacterium bovis Carboxylesterase A, caeA, rv2224c MT2282, Hydrolase important for pathogenesis 1 (Hip1)

Comment

"Hydrolase important for pathogenesis 1 (Hip1, rv2224c). Serine protease that promotes tuberculosis (TB) pathogenesis by promoting the processing and the extracellular release of the M.tuberculosis (Mtb) heat-shock protein GroEL2. In vitro, catalyzes the cleavage of ester bonds. Esterase activity increases with increasing carbon chain length of the substrate. There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains."

Relationship

Family : Tiancimycin-TnmK-Tripeptidase-HIP

Block : X

Position in NCBI Life Tree : Mycobacterium tuberculosis

Molecular evidence

No mutation

No kinetic

No disease

Database

Sequence

Peptide

MGMRLSRRDKIARMLLIWAALAAVALVLVGCIRVVGGRAR
MAEPKLGQPV EWTPCRSSNPQVKIPGGALCGKLAVPVDY
DRPDGDVAALALIRFPATGDK IGSLVINPGGPGESGIEA
ALGVFQTLPKRVHERFDLVGFDPRGVASSRPA IWCNSDA
DNDRLRAEPQVDYSREGVAHIENETKQFVGRCVDKMGKNF
LAH VGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGSA
YAEEFPQRVRAMIL DGAVDPNADPIEAELRQAKGFQDAF
NNYAADCAKNAGCPLGADPAKAVEV YHSLVDPLVDPDNP
RISRPARTKDPRGLSYSDAIVGTIMALYSPNLWQHL TDG
LSELVDNRGDTLLALADMYMRRDSHGRYNNSGDARVAINC
VDQPPVT DRDKVIDEDRRAREIAPFMSYGKFTGDAPLGT
CAFWPVPPTSQPHAVSAP GLVPTVVVSTTHDPATPYKAG
VDLANQLRGSLLTFDGTQHTVVFQGDSCI DEYVTAYLIG
GTTPPSGAKC

References

Title : 2.1 A crystal structure of the Mycobacterium tuberculosis serine hydrolase, Hip1, in its anhydro-form (Anhydrohip1) - Brooks_2022_Biochem.Biophys.Res.Commun_630_57
Author(s) : Brooks CL , Ostrov DA , Schumann NC , Kakkad S , Li D , Pena K , Williams BP , Goldfarb NE
Ref : Biochemical & Biophysical Research Communications , 630 :57 , 2022
Abstract : Brooks_2022_Biochem.Biophys.Res.Commun_630_57
ESTHER : Brooks_2022_Biochem.Biophys.Res.Commun_630_57
PubMedSearch : Brooks_2022_Biochem.Biophys.Res.Commun_630_57
PubMedID: 36148729
Gene_locus related to this paper: myctu-ym24

Title : Chemiluminescent Protease Probe for Rapid, Sensitive, and Inexpensive Detection of Live Mycobacterium tuberculosis - Babin_2021_ACS.Cent.Sci_7_803
Author(s) : Babin BM , Fernandez-Cuervo G , Sheng J , Green O , Ordonez AA , Turner ML , Keller LJ , Jain SK , Shabat D , Bogyo M
Ref : ACS Cent Sci , 7 :803 , 2021
Abstract : Babin_2021_ACS.Cent.Sci_7_803
ESTHER : Babin_2021_ACS.Cent.Sci_7_803
PubMedSearch : Babin_2021_ACS.Cent.Sci_7_803
PubMedID: 34079897
Gene_locus related to this paper: myctu-ym24

Title : Mycobacterium tuberculosis GroEL2 Modulates Dendritic Cell Responses - Georgieva_2018_Infect.Immun_86_
Author(s) : Georgieva M , Sia JK , Bizzell E , Madan-Lala R , Rengarajan J
Ref : Infect Immun , 86 : , 2018
Abstract : Georgieva_2018_Infect.Immun_86_
ESTHER : Georgieva_2018_Infect.Immun_86_
PubMedSearch : Georgieva_2018_Infect.Immun_86_
PubMedID: 29133346
Gene_locus related to this paper: myctu-ym24

Title : Deletion of BCG Hip1 protease enhances dendritic cell and CD4 T cell responses - Bizzell_2018_J.Leukoc.Biol_103_739
Author(s) : Bizzell E , Sia JK , Quezada M , Enriquez A , Georgieva M , Rengarajan J
Ref : J Leukoc Biol , 103 :739 , 2018
Abstract : Bizzell_2018_J.Leukoc.Biol_103_739
ESTHER : Bizzell_2018_J.Leukoc.Biol_103_739
PubMedSearch : Bizzell_2018_J.Leukoc.Biol_103_739
PubMedID: 29345365
Gene_locus related to this paper: myctu-ym24

Title : Structure Determination of Mycobacterium tuberculosis Serine Protease Hip1 (Rv2224c) - Naffin-Olivos_2017_Biochemistry_56_2304
Author(s) : Naffin-Olivos JL , Daab A , White A , Goldfarb NE , Milne AC , Liu D , Baikovitz J , Dunn BM , Rengarajan J , Petsko GA , Ringe D
Ref : Biochemistry , 56 :2304 , 2017
Abstract : Naffin-Olivos_2017_Biochemistry_56_2304
ESTHER : Naffin-Olivos_2017_Biochemistry_56_2304
PubMedSearch : Naffin-Olivos_2017_Biochemistry_56_2304
PubMedID: 28346784
Gene_locus related to this paper: myctu-ym24

Title : Design of Selective Substrates and Activity-Based Probes for Hydrolase Important for Pathogenesis 1 (HIP1) from Mycobacterium tuberculosis - Lentz_2016_ACS.Infect.Dis_2_807
Author(s) : Lentz CS , Ordonez AA , Kasperkiewicz P , La Greca F , O'Donoghue AJ , Schulze CJ , Powers JC , Craik CS , Drag M , Jain SK , Bogyo M
Ref : ACS Infect Dis , 2 :807 , 2016
Abstract : Lentz_2016_ACS.Infect.Dis_2_807
ESTHER : Lentz_2016_ACS.Infect.Dis_2_807
PubMedSearch : Lentz_2016_ACS.Infect.Dis_2_807
PubMedID: 27739665
Gene_locus related to this paper: myctu-ym24

Title : Small-Molecule Probes Reveal Esterases with Persistent Activity in Dormant and Reactivating Mycobacterium tuberculosis - Tallman_2016_ACS.Infect.Dis_2_936
Author(s) : Tallman KR , Levine SR , Beatty KE
Ref : ACS Infect Dis , 2 :936 , 2016
Abstract : Tallman_2016_ACS.Infect.Dis_2_936
ESTHER : Tallman_2016_ACS.Infect.Dis_2_936
PubMedSearch : Tallman_2016_ACS.Infect.Dis_2_936
PubMedID: 27690385
Gene_locus related to this paper: myctu-rv0183 , myctu-Rv1399c , myctu-RV1683 , myctu-Rv2284 , myctu-Rv2970c , myctu-ym24

Title : The alpha\/beta Hydrolase Fold Proteins of Mycobacterium tuberculosis, With Reference to their Contribution to Virulence - Johnson_2017_Curr.Protein.Pept.Sci_18_190
Author(s) : Johnson G
Ref : Curr Protein Pept Sci , 18 :190 , 2016
Abstract : Johnson_2017_Curr.Protein.Pept.Sci_18_190
ESTHER : Johnson_2017_Curr.Protein.Pept.Sci_18_190
PubMedSearch : Johnson_2017_Curr.Protein.Pept.Sci_18_190
PubMedID: 27480283
Gene_locus related to this paper: myctu-bpoC , myctu-metx , myctu-MT1628 , myctu-MT3441 , myctu-RV0421C , myctu-RV0519C , myctu-RV0774C , myctu-Rv1191 , myctu-Rv3084 , myctu-Rv3591c , myctu-yc88 , myctu-a85a , myctu-a85b , myctu-a85c , myctu-cut3 , myctu-cutas1 , myctu-cutas2 , myctu-d5yk66 , myctu-ephA , myctu-ephB , myctu-ephc , myctu-ephd , myctu-ephE , myctu-ephF , myctu-hpx , myctu-linb , myctu-lipG , myctu-lipJ , myctu-LIPS , myctu-lipv , myctu-LPQC , myctu-LPQP , myctu-MBTB , myctu-mpt51 , myctu-p71654 , myctu-p95011 , myctu-PKS6 , myctu-PKS13 , myctu-ppe42 , myctu-ppe63 , myctu-Rv1430 , myctu-RV0045C , myctu-Rv0077c , myctu-Rv0151c , myctu-Rv0152c , myctu-Rv0159c , myctu-Rv0160c , myctu-rv0183 , myctu-Rv0217c , myctu-Rv0220 , myctu-Rv0272c , myctu-RV0293C , myctu-RV0457C , myctu-RV0782 , myctu-RV0840C , myctu-Rv1069c , myctu-Rv1076 , myctu-RV1123C , myctu-Rv1184c , myctu-Rv1190 , myctu-RV1192 , myctu-RV1215C , myctu-Rv1399c , myctu-Rv1400c , myctu-Rv1426c , myctu-RV1639C , myctu-RV1683 , myctu-RV1758 , myctu-Rv1800 , myctu-Rv1833c , myctu-Rv2045c , myctu-RV2054 , myctu-Rv2284 , myctu-RV2296 , myctu-Rv2385 , myctu-Rv2485c , myctu-RV2627C , myctu-RV2672 , myctu-RV2695 , myctu-RV2765 , myctu-RV2800 , myctu-RV2854 , myctu-Rv2970c , myctu-Rv3097c , myctu-rv3177 , myctu-Rv3312c , myctu-RV3452 , myctu-RV3473C , myctu-Rv3487c , myctu-Rv3569c , myctu-RV3724 , myctu-Rv3802c , myctu-Rv3822 , myctu-y0571 , myctu-y963 , myctu-Y1834 , myctu-y1835 , myctu-y2079 , myctu-Y2307 , myctu-ym23 , myctu-ym24 , myctu-YR15 , myctu-yt28

Title : Mycobacterium tuberculosis Hip1 modulates macrophage responses through proteolysis of GroEL2 - Naffin-Olivos_2014_PLoS.Pathog_10_e1004132
Author(s) : Naffin-Olivos JL , Georgieva M , Goldfarb N , Madan-Lala R , Dong L , Bizzell E , Valinetz E , Brandt GS , Yu S , Shabashvili DE , Ringe D , Dunn BM , Petsko GA , Rengarajan J
Ref : PLoS Pathog , 10 :e1004132 , 2014
Abstract : Naffin-Olivos_2014_PLoS.Pathog_10_e1004132
ESTHER : Naffin-Olivos_2014_PLoS.Pathog_10_e1004132
PubMedSearch : Naffin-Olivos_2014_PLoS.Pathog_10_e1004132
PubMedID: 24830429
Gene_locus related to this paper: myctu-ym24

Title : Mycobacterium tuberculosis impairs dendritic cell functions through the serine hydrolase Hip1 - Madan-Lala_2014_J.Immunol_192_4263
Author(s) : Madan-Lala R , Sia JK , King R , Adekambi T , Monin L , Khader SA , Pulendran B , Rengarajan J
Ref : J Immunol , 192 :4263 , 2014
Abstract : Madan-Lala_2014_J.Immunol_192_4263
ESTHER : Madan-Lala_2014_J.Immunol_192_4263
PubMedSearch : Madan-Lala_2014_J.Immunol_192_4263
PubMedID: 24659689
Gene_locus related to this paper: myctu-ym24

Title : Mycobacterium tuberculosis Hip1 dampens macrophage proinflammatory responses by limiting toll-like receptor 2 activation - Madan-Lala_2011_Infect.Immun_79_4828
Author(s) : Madan-Lala R , Peixoto KV , Re F , Rengarajan J
Ref : Infect Immun , 79 :4828 , 2011
Abstract : Madan-Lala_2011_Infect.Immun_79_4828
ESTHER : Madan-Lala_2011_Infect.Immun_79_4828
PubMedSearch : Madan-Lala_2011_Infect.Immun_79_4828
PubMedID: 21947769
Gene_locus related to this paper: myctu-ym24

Title : Whole genome sequence analysis of Mycobacterium bovis bacillus Calmette-Guerin (BCG) Tokyo 172: a comparative study of BCG vaccine substrains - Seki_2009_Vaccine_27_1710
Author(s) : Seki M , Honda I , Fujita I , Yano I , Yamamoto S , Koyama A
Ref : Vaccine , 27 :1710 , 2009
Abstract : Seki_2009_Vaccine_27_1710
ESTHER : Seki_2009_Vaccine_27_1710
PubMedSearch : Seki_2009_Vaccine_27_1710
PubMedID: 19200449
Gene_locus related to this paper: myctu-a85a , myctu-a85b , myctu-a85c , myctu-bpoC , myctu-cut3 , myctu-cutas1 , myctu-cutas2 , myctu-d5yk66 , myctu-ephB , myctu-ephc , myctu-ephd , myctu-ephE , myctu-hpx , myctu-linb , myctu-lipG , myctu-lipJ , myctu-LIPS , myctu-lipv , myctu-LPQC , myctu-LPQP , myctu-MBTB , myctu-metx , myctu-mpt51 , myctu-MT1628 , myctu-MT3441 , myctu-p71654 , myctu-p95011 , myctu-PKS6 , myctu-PKS13 , myctu-ppe42 , myctu-ppe63 , myctu-Rv1430 , myctu-RV0045C , myctu-Rv0077c , myctu-Rv0151c , myctu-Rv0152c , myctu-Rv0159c , myctu-Rv0160c , myctu-rv0183 , myctu-Rv0217c , myctu-Rv0220 , myctu-Rv0272c , myctu-RV0293C , myctu-RV0457C , myctu-RV0519C , myctu-RV0774C , myctu-RV0782 , myctu-RV0840C , myctu-Rv1069c , myctu-Rv1076 , myctu-RV1123C , myctu-Rv1184c , myctu-Rv1190 , myctu-Rv1191 , myctu-RV1192 , myctu-RV1215C , myctu-Rv1399c , myctu-Rv1400c , myctu-Rv1426c , myctu-RV1639C , myctu-RV1683 , myctu-RV1758 , myctu-Rv1800 , myctu-Rv1833c , myctu-Rv2045c , myctu-RV2054 , myctu-RV2296 , myctu-Rv2385 , myctu-RV2627C , myctu-RV2672 , myctu-RV2695 , myctu-RV2765 , myctu-RV2800 , myctu-RV2854 , myctu-Rv2970c , myctu-Rv3084 , myctu-Rv3097c , myctu-rv3177 , myctu-Rv3312c , myctu-RV3452 , myctu-RV3473C , myctu-Rv3487c , myctu-Rv3569c , myctu-Rv3591c , myctu-RV3724 , myctu-Rv3802c , myctu-Rv3822 , myctu-y0571 , myctu-y963 , myctu-Y1834 , myctu-y1835 , myctu-y2079 , myctu-yc88 , myctu-ym23 , myctu-ym24 , myctu-YR15 , myctu-yt28

Title : Mycobacterium tuberculosis Rv2224c modulates innate immune responses - Rengarajan_2008_Proc.Natl.Acad.Sci.U.S.A_105_264
Author(s) : Rengarajan J , Murphy E , Park A , Krone CL , Hett EC , Bloom BR , Glimcher LH , Rubin EJ
Ref : Proc Natl Acad Sci U S A , 105 :264 , 2008
Abstract : Rengarajan_2008_Proc.Natl.Acad.Sci.U.S.A_105_264
ESTHER : Rengarajan_2008_Proc.Natl.Acad.Sci.U.S.A_105_264
PubMedSearch : Rengarajan_2008_Proc.Natl.Acad.Sci.U.S.A_105_264
PubMedID: 18172199
Gene_locus related to this paper: myctu-ym24

Title : Characterization of a novel cell wall-anchored protein with carboxylesterase activity required for virulence in Mycobacterium tuberculosis - Lun_2007_J.Biol.Chem_282_18348
Author(s) : Lun S , Bishai WR
Ref : Journal of Biological Chemistry , 282 :18348 , 2007
Abstract : Lun_2007_J.Biol.Chem_282_18348
ESTHER : Lun_2007_J.Biol.Chem_282_18348
PubMedSearch : Lun_2007_J.Biol.Chem_282_18348
PubMedID: 17428787
Gene_locus related to this paper: myctu-ym23 , myctu-ym24

Title : Genome plasticity of BCG and impact on vaccine efficacy - Brosch_2007_Proc.Natl.Acad.Sci.U.S.A_104_5596
Author(s) : Brosch R , Gordon SV , Garnier T , Eiglmeier K , Frigui W , Valenti P , Dos Santos S , Duthoy S , Lacroix C , Garcia-Pelayo C , Inwald JK , Golby P , Garcia JN , Hewinson RG , Behr MA , Quail MA , Churcher C , Barrell BG , Parkhill J , Cole ST
Ref : Proc Natl Acad Sci U S A , 104 :5596 , 2007
Abstract : Brosch_2007_Proc.Natl.Acad.Sci.U.S.A_104_5596
ESTHER : Brosch_2007_Proc.Natl.Acad.Sci.U.S.A_104_5596
PubMedSearch : Brosch_2007_Proc.Natl.Acad.Sci.U.S.A_104_5596
PubMedID: 17372194
Gene_locus related to this paper: myctu-a85a , myctu-a85b , myctu-a85c , myctu-bpoC , myctu-cut3 , myctu-cutas2 , myctu-d5yk66 , myctu-ephB , myctu-ephc , myctu-ephd , myctu-ephE , myctu-hpx , myctu-linb , myctu-lipG , myctu-lipJ , myctu-LIPS , myctu-lipv , myctu-LPQC , myctu-LPQP , myctu-MBTB , myctu-metx , myctu-mpt51 , myctu-MT1628 , myctu-p71654 , myctu-p95011 , myctu-PKS6 , myctu-PKS13 , myctu-ppe42 , myctu-ppe63 , myctu-Rv1430 , myctu-RV0045C , myctu-Rv0077c , myctu-Rv0151c , myctu-Rv0152c , myctu-Rv0159c , myctu-Rv0160c , myctu-rv0183 , myctu-Rv0217c , myctu-Rv0220 , myctu-Rv0272c , myctu-RV0293C , myctu-RV0457C , myctu-RV0519C , myctu-RV0774C , myctu-RV0782 , myctu-RV0840C , myctu-Rv1069c , myctu-Rv1076 , myctu-RV1123C , myctu-Rv1184c , myctu-Rv1191 , myctu-RV1192 , myctu-RV1215C , myctu-Rv1399c , myctu-Rv1400c , myctu-Rv1426c , myctu-RV1639C , myctu-RV1683 , myctu-RV1758 , myctu-Rv1800 , myctu-Rv1833c , myctu-Rv2045c , myctu-RV2054 , myctu-Rv2284 , myctu-RV2296 , myctu-Rv2385 , myctu-Rv2485c , myctu-RV2627C , myctu-RV2672 , myctu-RV2695 , myctu-RV2765 , myctu-RV2800 , myctu-RV2854 , myctu-Rv2970c , myctu-Rv3084 , myctu-Rv3097c , myctu-rv3177 , myctu-Rv3312c , myctu-RV3452 , myctu-RV3473C , myctu-Rv3487c , myctu-Rv3569c , myctu-Rv3591c , myctu-RV3724 , myctu-Rv3802c , myctu-Rv3822 , myctu-y0571 , myctu-y963 , myctu-Y1834 , myctu-y1835 , myctu-y2079 , myctu-yc88 , myctu-ym23 , myctu-ym24 , myctu-YR15 , myctu-yt28

Title : The complete genome sequence of Mycobacterium bovis - Garnier_2003_Proc.Natl.Acad.Sci.U.S.A_100_7877
Author(s) : Garnier T , Eiglmeier K , Camus JC , Medina N , Mansoor H , Pryor M , Duthoy S , Grondin S , Lacroix C , Monsempe C , Simon S , Harris B , Atkin R , Doggett J , Mayes R , Keating L , Wheeler PR , Parkhill J , Barrell BG , Cole ST , Gordon SV , Hewinson RG
Ref : Proc Natl Acad Sci U S A , 100 :7877 , 2003
Abstract : Garnier_2003_Proc.Natl.Acad.Sci.U.S.A_100_7877
ESTHER : Garnier_2003_Proc.Natl.Acad.Sci.U.S.A_100_7877
PubMedSearch : Garnier_2003_Proc.Natl.Acad.Sci.U.S.A_100_7877
PubMedID: 12788972
Gene_locus related to this paper: myctu-a85a , myctu-a85b , myctu-a85c , myctu-bpoC , myctu-cut3 , myctu-cutas1 , myctu-cutas2 , myctu-d5yk66 , myctu-ephB , myctu-ephc , myctu-ephd , myctu-ephE , myctu-hpx , myctu-linb , myctu-lipG , myctu-lipJ , myctu-LIPS , myctu-lipv , myctu-LPQC , myctu-LPQP , myctu-MBTB , myctu-metx , myctu-mpt51 , myctu-MT1628 , myctu-MT3441 , myctu-p71654 , myctu-p95011 , myctu-PKS6 , myctu-PKS13 , myctu-ppe42 , myctu-ppe63 , myctu-Rv1430 , myctu-RV0045C , myctu-Rv0077c , myctu-Rv0151c , myctu-Rv0152c , myctu-Rv0159c , myctu-Rv0160c , myctu-rv0183 , myctu-Rv0217c , myctu-Rv0220 , myctu-Rv0272c , myctu-RV0293C , myctu-RV0421C , myctu-RV0457C , myctu-RV0519C , myctu-RV0774C , myctu-RV0782 , myctu-RV0840C , myctu-Rv1069c , myctu-Rv1076 , myctu-RV1123C , myctu-Rv1184c , myctu-Rv1190 , myctu-Rv1191 , myctu-RV1192 , myctu-RV1215C , myctu-Rv1399c , myctu-Rv1400c , myctu-Rv1426c , myctu-RV1639C , myctu-RV1683 , myctu-RV1758 , myctu-Rv1800 , myctu-Rv1833c , myctu-Rv2045c , myctu-RV2054 , myctu-Rv2284 , myctu-RV2296 , myctu-Rv2385 , myctu-Rv2485c , myctu-RV2627C , myctu-RV2672 , myctu-RV2695 , myctu-RV2765 , myctu-RV2800 , myctu-RV2854 , myctu-Rv2970c , myctu-Rv3084 , myctu-Rv3097c , myctu-rv3177 , myctu-Rv3312c , myctu-RV3452 , myctu-RV3473C , myctu-Rv3487c , myctu-Rv3569c , myctu-RV3724 , myctu-Rv3802c , myctu-Rv3822 , myctu-y0571 , myctu-y963 , myctu-Y1834 , myctu-y1835 , myctu-y2079 , myctu-Y2307 , myctu-yc88 , myctu-ym23 , myctu-ym24 , myctu-YR15 , myctu-yt28

Title : Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains - Fleischmann_2002_J.Bacteriol_184_5479
Author(s) : Fleischmann RD , Alland D , Eisen JA , Carpenter L , White O , Peterson J , Deboy R , Dodson R , Gwinn M , Haft D , Hickey E , Kolonay JF , Nelson WC , Umayam LA , Ermolaeva M , Salzberg SL , Delcher A , Utterback T , Weidman J , Khouri H , Gill J , Mikula A , Bishai W , Jacobs Jr WR, Jr. , Venter JC , Fraser CM
Ref : Journal of Bacteriology , 184 :5479 , 2002
Abstract : Fleischmann_2002_J.Bacteriol_184_5479
ESTHER : Fleischmann_2002_J.Bacteriol_184_5479
PubMedSearch : Fleischmann_2002_J.Bacteriol_184_5479
PubMedID: 12218036
Gene_locus related to this paper: myctu-a85a , myctu-a85b , myctu-a85c , myctu-bpoC , myctu-d5yk66 , myctu-ephA , myctu-ephB , myctu-ephc , myctu-ephd , myctu-ephE , myctu-ephF , myctu-hpx , myctu-linb , myctu-lipG , myctu-LPQP , myctu-MBTB , myctu-metx , myctu-mpt51 , myctu-MT3441 , myctu-p71654 , myctu-p95011 , myctu-PKS6 , myctu-PKS13 , myctu-ppe42 , myctu-ppe63 , myctu-Rv1430 , myctu-RV0045C , myctu-Rv0077c , myctu-Rv0151c , myctu-Rv0152c , myctu-Rv0159c , myctu-Rv0160c , myctu-rv0183 , myctu-Rv0217c , myctu-Rv0220 , myctu-Rv0272c , myctu-RV0293C , myctu-RV0421C , myctu-RV0457C , myctu-RV0519C , myctu-RV0774C , myctu-RV0782 , myctu-RV0840C , myctu-Rv1069c , myctu-Rv1076 , myctu-RV1123C , myctu-Rv1184c , myctu-Rv1190 , myctu-Rv1191 , myctu-RV1192 , myctu-RV1215C , myctu-Rv1399c , myctu-Rv1400c , myctu-RV1639C , myctu-RV1683 , myctu-RV1758 , myctu-Rv1800 , myctu-Rv1833c , myctu-Rv2045c , myctu-RV2054 , myctu-Rv2284 , myctu-RV2296 , myctu-Rv2385 , myctu-Rv2485c , myctu-RV2627C , myctu-RV2672 , myctu-RV2695 , myctu-RV2765 , myctu-RV2800 , myctu-RV2854 , myctu-Rv2970c , myctu-Rv3084 , myctu-Rv3097c , myctu-rv3177 , myctu-Rv3312c , myctu-RV3452 , myctu-Rv3487c , myctu-Rv3569c , myctu-Rv3591c , myctu-RV3724 , myctu-Rv3802c , myctu-Rv3822 , myctu-y0571 , myctu-y963 , myctu-Y1834 , myctu-y1835 , myctu-y2079 , myctu-Y2307 , myctu-yc88 , myctu-ym23 , myctu-ym24 , myctu-YR15 , myctu-yt28

Title : Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence - Cole_1998_Nature_393_537
Author(s) : Cole ST , Brosch R , Parkhill J , Garnier T , Churcher C , Harris D , Gordon SV , Eiglmeier K , Gas S , Barry CE, 3rd , Tekaia F , Badcock K , Basham D , Brown D , Chillingworth T , Connor R , Davies R , Devlin K , Feltwell T , Gentles S , Hamlin N , Holroyd S , Hornsby T , Jagels K , Krogh A , McLean J , Moule S , Murphy L , Oliver K , Osborne J , Quail MA , Rajandream MA , Rogers J , Rutter S , Seeger K , Skelton J , Squares R , Squares S , Sulston JE , Taylor K , Whitehead S , Barrell BG
Ref : Nature , 393 :537 , 1998
Abstract : Cole_1998_Nature_393_537
ESTHER : Cole_1998_Nature_393_537
PubMedSearch : Cole_1998_Nature_393_537
PubMedID: 9634230
Gene_locus related to this paper: myctu-a85a , myctu-a85b , myctu-a85c , myctu-bpoC , myctu-cut3 , myctu-cutas1 , myctu-cutas2 , myctu-d5yk66 , myctu-ephA , myctu-ephB , myctu-ephc , myctu-ephd , myctu-ephE , myctu-ephF , myctu-hpx , myctu-linb , myctu-lipG , myctu-lipJ , myctu-LIPS , myctu-lipv , myctu-LPQC , myctu-LPQP , myctu-MBTB , myctu-metx , myctu-mpt51 , myctu-MT1628 , myctu-MT3441 , myctu-p71654 , myctu-p95011 , myctu-PKS6 , myctu-PKS13 , myctu-ppe42 , myctu-ppe63 , myctu-Rv1430 , myctu-RV0045C , myctu-Rv0077c , myctu-Rv0151c , myctu-Rv0152c , myctu-Rv0159c , myctu-Rv0160c , myctu-rv0183 , myctu-Rv0217c , myctu-Rv0220 , myctu-Rv0272c , myctu-RV0293C , myctu-RV0421C , myctu-RV0457C , myctu-RV0519C , myctu-RV0774C , myctu-RV0782 , myctu-RV0840C , myctu-Rv1069c , myctu-Rv1076 , myctu-RV1123C , myctu-Rv1184c , myctu-Rv1190 , myctu-Rv1191 , myctu-RV1192 , myctu-RV1215C , myctu-Rv1399c , myctu-Rv1400c , myctu-Rv1426c , myctu-RV1639C , myctu-RV1683 , myctu-RV1758 , myctu-Rv1800 , myctu-Rv1833c , myctu-RV2054 , myctu-RV2296 , myctu-Rv2385 , myctu-Rv2485c , myctu-RV2627C , myctu-RV2672 , myctu-RV2695 , myctu-RV2765 , myctu-RV2800 , myctu-RV2854 , myctu-Rv2970c , myctu-Rv3084 , myctu-Rv3097c , myctu-rv3177 , myctu-Rv3312c , myctu-RV3452 , myctu-RV3473C , myctu-Rv3487c , myctu-Rv3569c , myctu-Rv3591c , myctu-RV3724 , myctu-Rv3802c , myctu-Rv3822 , myctu-y0571 , myctu-y963 , myctu-Y1834 , myctu-y1835 , myctu-y2079 , myctu-Y2307 , myctu-yc88 , myctu-ym23 , myctu-ym24 , myctu-YR15 , myctu-yt28