Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: staau-SAV1793

Staphylococcus aureus YtmA S9C family unassigned peptidase, an hypothetical protein sav1793 FphG

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|ACPH_Peptidase_S9
Block| X
Position in NCBI Life Tree|Staphylococcus aureus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Staphylococcaceae: N E > Staphylococcus: N E > Staphylococcus aureus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: staau-SAV1793
Colored MSA for ACPH_Peptidase_S9 (raw)
MDFIKRKRMPIESFTHQFEEITYLSDDLQVKALMMTPHHEVNRIVVYLRG
GKGQVGRVRAGRLMQFSDSQTLVIGPYYRGNNGSEGKDEFYRGDLNDVTQ
LLRLLHDKYPHAFIHMVGFSRGGLQGLLTFQDLPVTSYTIWGGVSDIDLM
YEERVDLRGMLRRMIGHPKKDRAAYEARQAIPNINENSPPILIVHGGKDQ
QVGIHHAYYLADQLELKGATHETFYQMAEGHVPRPPAMVETLTYIKEFMK
QVELHS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDFIKRKRMPIESFTHQFEEITYLSDDLQVKALMMTPHHEVNRIVVYLRG
GKGQVGRVRAGRLMQFSDSQTLVIGPYYRGNNGSEGKDEFYRGDLNDVTQ
LLRLLHDKYPHAFIHMVGFSRGGLQGLLTFQDLPVTSYTIWGGVSDIDLM
YEERVDLRGMLRRMIGHPKKDRAAYEARQAIPNINENSPPILIVHGGKDQ
QVGIHHAYYLADQLELKGATHETFYQMAEGHVPRPPAMVETLTYIKEFMK
QVELHS


References
17 more
    Title: Newly discovered Staphylococcus aureus serine hydrolase probe and drug targets
    Fellner M
    Ref: ADMET & DMPK, 10:107, 2022 : PubMed

            

    Title: Structural basis for the inhibitor and substrate specificity of the unique Fph serine hydrolases of Staphylococcus aureus
    Fellner M, Lentz CS, Jamieson SA, Brewster JL, Chen L, Bogyo M, Mace PD
    Ref: ACS Infect Dis, 6:2771, 2020 : PubMed

            

    Title: Genome and virulence determinants of high virulence community-acquired MRSA
    Baba T, Takeuchi F, Kuroda M, Yuzawa H, Aoki K, Oguchi A, Nagai Y, Iwama N, Asano K and Hiramatsu K <4 more author(s)>
    Ref: Lancet, 359:1819, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer