Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-SCP25

Arabidopsis thaliana (Mouse-ear cress) putative serine carboxypeptidase II SCPL25 AT3G02110

Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AC011664, AY088154
1 UniProt : Q8L9Y0
1 UniProt : Q8L9Y0
1 Interpro : Q8L9Y0
1 Prodom : Q8L9Y0
1 Pfam : Q8L9Y0
1 PIRSF : Q8L9Y0
1 SUPERFAM : Q8L9Y0
1 Tair database : AT3G02110
Sequence
Graphical view for this peptide sequence: arath-SCP25
Colored MSA for Carboxypeptidase_S10 (raw)
MAMAKLAIFTTLMAILVMTSQGRIPTEGGEKEAEADRITSLPGQPNVTFE
QFSGYVTVDKLSGRSLFYWLTEASDLPLSKPLVIWLNGGPGCSSVAYGAS
EEIGPFRISKGGSGLYLNKFAWNSISNLLFLEAPAGVGFSYTNRSSDLFN
TGDRRTAKDSLQFLIQWLHRFPRYNHREIYITGESYAGHYVPQLAKEIMN
YNKRSKNPLNLKGIMVGNAVTDNHYDNLGTVSYWWSHAMISDRTYHQLIS
TCDFSRQKESDECETLYSYAMEQEFGNIDQYNIYAPPCNKSSDGGGSYNG
SSGRRSMRLPHLPHSVLRKISGYDPCTERYAEIYYNRPDVQKALHANTTK
IPYKWTACSEVLNRNWNDTDSTVLPIYREMIAGGIRVWVFSGDVDSVVPV
TATRYSLARLSLSTKLPWYPWYVKKQVGGWTEVYEGLTFVTVRGAGHEVP
LFKPRAAFELFKYFLRGKPLPKA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAMAKLAIFTTLMAILVMTSQGRIPTEGGEKEAEADRITSLPGQPNVTFE
QFSGYVTVDKLSGRSLFYWLTEASDLPLSKPLVIWLNGGPGCSSVAYGAS
EEIGPFRISKGGSGLYLNKFAWNSISNLLFLEAPAGVGFSYTNRSSDLFN
TGDRRTAKDSLQFLIQWLHRFPRYNHREIYITGESYAGHYVPQLAKEIMN
YNKRSKNPLNLKGIMVGNAVTDNHYDNLGTVSYWWSHAMISDRTYHQLIS
TCDFSRQKESDECETLYSYAMEQEFGNIDQYNIYAPPCNKSSDGGGSYNG
SSGRRSMRLPHLPHSVLRKISGYDPCTERYAEIYYNRPDVQKALHANTTK
IPYKWTACSEVLNRNWNDTDSTVLPIYREMIAGGIRVWVFSGDVDSVVPV
TATRYSLARLSLSTKLPWYPWYVKKQVGGWTEVYEGLTFVTVRGAGHEVP
LFKPRAAFELFKYFLRGKPLPKA


References
    Title: An expression and bioinformatics analysis of the Arabidopsis serine carboxypeptidase-like gene family
    Fraser CM, Rider LW, Chapple C
    Ref: Plant Physiol, 138:1136, 2005 : PubMed

            

    Title: Empirical analysis of transcriptional activity in the Arabidopsis genome
    Yamada K, Lim J, Dale JM, Chen H, Shinn P, Palm CJ, Southwick AM, Wu HC, Kim C and Ecker JR <60 more author(s)>
    Ref: Science, 302:842, 2003 : PubMed

            

    Title: Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana
    Salanoubat M, Lemcke K, Rieger M, Ansorge W, Unseld M, Fartmann B, Valle G, Blocker H, Perez-Alonso M and Tabata S <127 more author(s)>
    Ref: Nature, 408:820, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer