human-CMBL

 
Homo sapiens (Human) Carboxymethylenebutenolidase homolog

Comment
Q8TED6 Q96DG6 2aa diff


Relationship
Family CMBL
Block X
Homo sapiens position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E

Molecular evidence
Database
No mutation
No structure
No kinetic

Substrate: CurDD , Olmesartan-medoxomil ,

>3 Genbank links 1 more: BC001573, AK074197, CH471102
2 UniProt : Q96DG6, B2RD36
2 UniProtTrembl : Q96DG6, B2RD36
2 Interpro : Q96DG6, B2RD36
2 Prodom : Q96DG6, B2RD36
2 Pfam : Q96DG6, B2RD36
2 PIRSF : Q96DG6, B2RD36
2 SUPERFAM : Q96DG6, B2RD36
2 QuickSwissBlast : Q96DG6, B2RD36
1 EntrezGene : 134147
1 SNP : 134147
1 UniGene : 192586
1 HUGO HGNC : 25090
1 OMIM : 613379
1 Ensembl : ENSG00000164237
 
Sequence
Graphical view for this peptide sequence: human-CMBL
Colored MSA for CMBL (raw)
MANEAYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQD
IFGWQLPNTRYIADMISGNGYTTIVPDFFVGQEPWDPSGDWSIFPEWLKT
RNAQKIDREISAILKYLKQQCHAQKIGIVGFCWGGTAVHHLMMKYSEFRA
GVSVYGIVKDSEDIYNLKNPTLFIFAENDVVIPLKDVSLLTQKLKEHCKV
EYQIKTFSGQTHGFVHRKREDCSPADKPYIDEARRNLIEWLNKYM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MANEAYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQD
IFGWQLPNTRYIADMISGNGYTTIVPDFFVGQEPWDPSGDWSIFPEWLKT
RNAQKIDREISAILKYLKQQCHAQKIGIVGFCWGGTAVHHLMMKYSEFRA
GVSVYGIVKDSEDIYNLKNPTLFIFAENDVVIPLKDVSLLTQKLKEHCKV
EYQIKTFSGQTHGFVHRKREDCSPADKPYIDEARRNLIEWLNKYM

no DNA




References
    Title: Interindividual variability of carboxymethylenebutenolidase homolog, a novel olmesartan medoxomil hydrolase, in the human liver and intestine
    Ishizuka T, Rozehnal V, Fischer T, Kato A, Endo S, Yoshigae Y, Kurihara A, Izumi T
    Ref: Drug Metabolism & Disposition: The Biological Fate of Chemicals, 41:1156, 2013 : PubMed

            

    Title: Human carboxymethylenebutenolidase as a bioactivating hydrolase of olmesartan medoxomil in liver and intestine
    Ishizuka T, Fujimori I, Kato M, Noji-Sakikawa C, Saito M, Yoshigae Y, Kubota K, Kurihara A, Izumi T and Okazaki O <1 more author(s)>
    Ref: Journal of Biological Chemistry, 285:11892, 2010 : PubMed

            

    Title: The sequence of the human genome
    Venter JC, Adams MD, Myers EW, Li PW, Mural RJ, Sutton GG, Smith HO, Yandell M, Evans CA and Zhu X <264 more author(s)>
    Ref: Science, 291:1304, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer