human-PAFAH2

Homo sapiens (Human) (EC 3.1.1.47) platelet-activating factor acetylhydrolase 2, cytoplasmic (serine dependent phospholipase a2) (hsd-pla2), PAFAH2, PAFA2 PAF-AH

Comment

"multifunctional enzyme with three catalytic activities\; PAF:lysophospholipid transacetylase\; PAF:sphingosine transacetylase\; \;Platelet-activating factor acetyltransferase PAFAH2. EC:2.3.1.149 Serine-dependent phospholipase A2 SD-PLA2 hSD-PLA2. Oxidized-phospholipid-selective phospholipase A2"

Relationship

Family : PAF-Acetylhydrolase

Block : X

Position in NCBI Life Tree : Homo sapiens

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

Sequence

Peptide

MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPC
QKAEETMEQP LWIPRYEYCTGLAEYLQFNKRCGGLLFNL
AVGSCRLPVSWNGPFKTKDSG YPLIIFSHGLGAFRTLYS
AFCMELASRGFVVAVPEHRDRSAATTYFCKQA PEENQPT
NESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLK
ILQ EVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHS
FGGATAILALAKET QFRCAVALDAWMFPLERDFYPKARG
PVFFINTEKFQTMESVNLMKKICAQ HEQSRIITVLGSVH
RSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMV RAM
LAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL

References

Title : Platelet activating-factor acetylhydrolase II: A member of phospholipase A2 family that hydrolyzes oxidized phospholipids - Dong_2021_Chem.Phys.Lipids_239_105103
Author(s) : Dong L , Li Y , Wu H
Ref : Chemistry & Physic of Lipids , 239 :105103 , 2021
Abstract : Dong_2021_Chem.Phys.Lipids_239_105103
ESTHER : Dong_2021_Chem.Phys.Lipids_239_105103
PubMedSearch : Dong_2021_Chem.Phys.Lipids_239_105103
PubMedID: 34116047
Gene_locus related to this paper: human-PAFAH2

Title : Omega-3 fatty acid epoxides are autocrine mediators that control the magnitude of IgE-mediated mast cell activation - Shimanaka_2017_Nat.Med_23_1287
Author(s) : Shimanaka Y , Kono N , Taketomi Y , Arita M , Okayama Y , Tanaka Y , Nishito Y , Mochizuki T , Kusuhara H , Adibekian A , Cravatt BF , Murakami M , Arai H
Ref : Nat Med , 23 :1287 , 2017
Abstract : Shimanaka_2017_Nat.Med_23_1287
ESTHER : Shimanaka_2017_Nat.Med_23_1287
PubMedSearch : Shimanaka_2017_Nat.Med_23_1287
PubMedID: 29035365
Gene_locus related to this paper: human-PAFAH2

Title : Trafficking of platelet-activating factor acetylhydrolase type II in response to oxidative stress - Thevenin_2011_Biochemistry_50_8417
Author(s) : Thevenin AF , Monillas ES , Winget JM , Czymmek K , Bahnson BJ
Ref : Biochemistry , 50 :8417 , 2011
Abstract : Thevenin_2011_Biochemistry_50_8417
ESTHER : Thevenin_2011_Biochemistry_50_8417
PubMedSearch : Thevenin_2011_Biochemistry_50_8417
PubMedID: 21882811
Gene_locus related to this paper: human-PAFAH2

Title : Differential regulation of three catalytic activities of platelet-activating factor (PAF)-dependent transacetylase - Lee_2001_Arch.Biochem.Biophys_387_41
Author(s) : Lee T , Malone B , Longobardi L , Balestrieri ML
Ref : Archives of Biochemistry & Biophysics , 387 :41 , 2001
Abstract : Lee_2001_Arch.Biochem.Biophys_387_41
ESTHER : Lee_2001_Arch.Biochem.Biophys_387_41
PubMedSearch : Lee_2001_Arch.Biochem.Biophys_387_41
PubMedID: 11368182
Gene_locus related to this paper: human-PAFAH2

Title : The sequence of the human genome - Venter_2001_Science_291_1304
Author(s) : Venter JC , Adams MD , Myers EW , Li PW , Mural RJ , Sutton GG , Smith HO , Yandell M , Evans CA , Holt RA , Gocayne JD , Amanatides P , Ballew RM , Huson DH , Wortman JR , Zhang Q , Kodira CD , Zheng XH , Chen L , Skupski M , Subramanian G , Thomas PD , Zhang J , Gabor Miklos GL , Nelson C , Broder S , Clark AG , Nadeau J , McKusick VA , Zinder N , Levine AJ , Roberts RJ , Simon M , Slayman C , Hunkapiller M , Bolanos R , Delcher A , Dew I , Fasulo D , Flanigan M , Florea L , Halpern A , Hannenhalli S , Kravitz S , Levy S , Mobarry C , Reinert K , Remington K , Abu-Threideh J , Beasley E , Biddick K , Bonazzi V , Brandon R , Cargill M , Chandramouliswaran I , Charlab R , Chaturvedi K , Deng Z , Di Francesco V , Dunn P , Eilbeck K , Evangelista C , Gabrielian AE , Gan W , Ge W , Gong F , Gu Z , Guan P , Heiman TJ , Higgins ME , Ji RR , Ke Z , Ketchum KA , Lai Z , Lei Y , Li Z , Li J , Liang Y , Lin X , Lu F , Merkulov GV , Milshina N , Moore HM , Naik AK , Narayan VA , Neelam B , Nusskern D , Rusch DB , Salzberg S , Shao W , Shue B , Sun J , Wang Z , Wang A , Wang X , Wang J , Wei M , Wides R , Xiao C , Yan C , Yao A , Ye J , Zhan M , Zhang W , Zhang H , Zhao Q , Zheng L , Zhong F , Zhong W , Zhu S , Zhao S , Gilbert D , Baumhueter S , Spier G , Carter C , Cravchik A , Woodage T , Ali F , An H , Awe A , Baldwin D , Baden H , Barnstead M , Barrow I , Beeson K , Busam D , Carver A , Center A , Cheng ML , Curry L , Danaher S , Davenport L , Desilets R , Dietz S , Dodson K , Doup L , Ferriera S , Garg N , Gluecksmann A , Hart B , Haynes J , Haynes C , Heiner C , Hladun S , Hostin D , Houck J , Howland T , Ibegwam C , Johnson J , Kalush F , Kline L , Koduru S , Love A , Mann F , May D , McCawley S , McIntosh T , McMullen I , Moy M , Moy L , Murphy B , Nelson K , Pfannkoch C , Pratts E , Puri V , Qureshi H , Reardon M , Rodriguez R , Rogers YH , Romblad D , Ruhfel B , Scott R , Sitter C , Smallwood M , Stewart E , Strong R , Suh E , Thomas R , Tint NN , Tse S , Vech C , Wang G , Wetter J , Williams S , Williams M , Windsor S , Winn-Deen E , Wolfe K , Zaveri J , Zaveri K , Abril JF , Guigo R , Campbell MJ , Sjolander KV , Karlak B , Kejariwal A , Mi H , Lazareva B , Hatton T , Narechania A , Diemer K , Muruganujan A , Guo N , Sato S , Bafna V , Istrail S , Lippert R , Schwartz R , Walenz B , Yooseph S , Allen D , Basu A , Baxendale J , Blick L , Caminha M , Carnes-Stine J , Caulk P , Chiang YH , Coyne M , Dahlke C , Mays A , Dombroski M , Donnelly M , Ely D , Esparham S , Fosler C , Gire H , Glanowski S , Glasser K , Glodek A , Gorokhov M , Graham K , Gropman B , Harris M , Heil J , Henderson S , Hoover J , Jennings D , Jordan C , Jordan J , Kasha J , Kagan L , Kraft C , Levitsky A , Lewis M , Liu X , Lopez J , Ma D , Majoros W , McDaniel J , Murphy S , Newman M , Nguyen T , Nguyen N , Nodell M , Pan S , Peck J , Peterson M , Rowe W , Sanders R , Scott J , Simpson M , Smith T , Sprague A , Stockwell T , Turner R , Venter E , Wang M , Wen M , Wu D , Wu M , Xia A , Zandieh A , Zhu X
Ref : Science , 291 :1304 , 2001
Abstract : Venter_2001_Science_291_1304
ESTHER : Venter_2001_Science_291_1304
PubMedSearch : Venter_2001_Science_291_1304
PubMedID: 11181995
Gene_locus related to this paper: human-AADAC , human-ABHD1 , human-ABHD10 , human-ABHD11 , human-ACHE , human-BCHE , human-LDAH , human-ABHD18 , human-CMBL , human-ABHD17A , human-KANSL3 , human-LIPA , human-LYPLAL1 , human-NDRG2 , human-NLGN3 , human-NLGN4X , human-NLGN4Y , human-PAFAH2 , human-PREPL , human-RBBP9 , human-SPG21

Title : Expression, purification and characterization of a human serine-dependent phospholipase A2 with high specificity for oxidized phospholipids and platelet activating factor - Rice_1998_Biochem.J_330 ( Pt 3)_1309
Author(s) : Rice SQ , Southan C , Boyd HF , Terrett JA , Macphee CH , Moores K , Gloger IS , Tew DG
Ref : Biochemical Journal , 330 ( Pt 3) :1309 , 1998
Abstract : Rice_1998_Biochem.J_330 ( Pt 3)_1309
ESTHER : Rice_1998_Biochem.J_330 ( Pt 3)_1309
PubMedSearch : Rice_1998_Biochem.J_330 ( Pt 3)_1309
PubMedID: 9494101
Gene_locus related to this paper: human-PAFAH2

Title : Platelet-activating factor acetylhydrolases -
Author(s) : Stafforini DM , McIntyre TM , Zimmerman GA , Prescott SM
Ref : Journal of Biological Chemistry , 272 :17895 , 1997
PubMedID: 9218411
Gene_locus related to this paper: bovin-paf2 , human-PAFAH2

Title : cDNA cloning and expression of intracellular platelet-activating factor (PAF) acetylhydrolase II. Its homology with plasma PAF acetylhydrolase - Hattori_1996_J.Biol.Chem_271_33032
Author(s) : Hattori K , Adachi H , Matsuzawa A , Yamamoto K , Tsujimoto M , Aoki J , Hattori M , Arai H , Inoue K
Ref : Journal of Biological Chemistry , 271 :33032 , 1996
Abstract : Hattori_1996_J.Biol.Chem_271_33032
ESTHER : Hattori_1996_J.Biol.Chem_271_33032
PubMedSearch : Hattori_1996_J.Biol.Chem_271_33032
PubMedID: 8955149
Gene_locus related to this paper: bovin-paf2 , human-PAFAH2