mouse-acot4

 
Mus musculus (Mouse) peroxisomal long chain Acyl-CoA thioesterase Ib (pte-Ib) (pte-2b)

Comment
The mouse ACOT gene cluster comprises six genes with localizations in cytosol (ACOT1), mitochondria (ACOT2), and peroxisomes (ACOT3-6). The corresponding human gene cluster contains only three genes (ACOT1, ACOT2, and ACOT4) coding for full-length thioesterase proteins only ACOT4 is peroxisomal


Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 3 more: AF180801, AF180799, AF180800
1 UniProt : Q8BWN8
1 UniProtTrembl : Q8BWN8
1 Interpro : Q8BWN8
1 Prodom : Q8BWN8
1 Pfam : Q8BWN8
1 PIRSF : Q8BWN8
1 SUPERFAM : Q8BWN8
1 QuickSwissBlast : Q8BWN8
1 MGD : 2159621
2 ENSEMBL : Q9QYR8, ENSMUSG00000052392
 
Sequence
Graphical view for this peptide sequence: mouse-acot4
Colored MSA for Acyl-CoA_Thioesterase (raw)
MAATLSVEPTGRSCWDEPLSIAVRGLAPEQPVTLRSVLRDEKGALFRAHA
RYRADSHGELDLARVPALGGSFSGLEPMGLLWAMEPDRPFWRLIKRDVQT
PFLVELEVLDGHEPDGGRRLARTVHERHFMAPGVRGVPVREGRVRATLFL
PPGQGPFPGIIDVYGVGGGLLEYRAGLVAGHGFATLALAFYDFEDLPKEL
NVIEVDYFEEAVRYMLRHPKVKGPDIGLLGLSLGADVCLIMASFLNNVSA
TVSINGSAFSGNRHIKYKQTMIPPLGHDLRRMKVAFSGILDIVDIRNDAV
GGCENPSMIPIEKAKGPILFVAGQDDHCWRSELYTQIASDRLQAHGKERP
QVLSYPGTGHYIEPPYFPMCPASLHKIVNEAVIWGGEVKAHSKAQIDAWK
QILFFFGKHLGSTHSRASCRL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAATLSVEPTGRSCWDEPLSIAVRGLAPEQPVTLRSVLRDEKGALFRAHA
RYRADSHGELDLARVPALGGSFSGLEPMGLLWAMEPDRPFWRLIKRDVQT
PFLVELEVLDGHEPDGGRRLARTVHERHFMAPGVRGVPVREGRVRATLFL
PPGQGPFPGIIDVYGVGGGLLEYRAGLVAGHGFATLALAFYDFEDLPKEL
NVIEVDYFEEAVRYMLRHPKVKGPDIGLLGLSLGADVCLIMASFLNNVSA
TVSINGSAFSGNRHIKYKQTMIPPLGHDLRRMKVAFSGILDIVDIRNDAV
GGCENPSMIPIEKAKGPILFVAGQDDHCWRSELYTQIASDRLQAHGKERP
QVLSYPGTGHYIEPPYFPMCPASLHKIVNEAVIWGGEVKAHSKAQIDAWK
QILFFFGKHLGSTHSRASCRL

no DNA




References
1 more
    Title: The transcriptional landscape of the mammalian genome
    Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B and Hayashizaki Y <184 more author(s)>
    Ref: Science, 309:1559, 2005 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            

    Title: Peroxisome proliferator-induced long chain acyl-CoA thioesterases comprise a highly conserved novel multi-gene family involved in lipid metabolism
    Hunt MC, Nousiainen SE, Huttunen MK, Orii KE, Svensson LT, Alexson SE
    Ref: Journal of Biological Chemistry, 274:34317, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer