Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myctu-RV0519C

Mycobacterium tuberculosis, Mycobacterium bovis, hypothetical 31.4 kda protein RV0519C

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|A85-Feruloyl-Esterase
Block| X
Position in NCBI Life Tree|Mycobacterium tuberculosis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 8 more: Z97831, BX248335, BX842573
2 UniProt : O33364, A5TZP9
2 UniProt : O33364, A5TZP9
2 Interpro : O33364, A5TZP9
2 Prodom : O33364, A5TZP9
2 Pfam : O33364, A5TZP9
2 PIRSF : O33364, A5TZP9
2 SUPERFAM : O33364, A5TZP9
Sequence
Graphical view for this peptide sequence: myctu-RV0519C
Colored MSA for A85-Feruloyl-Esterase (raw)
MLRRGCAGNTDRRGIMTPMADLTRRALLRWGAGAGAGAAGVWAFGALVDP
LEPQAAPAPFEPPTAGSSLPTRISGSFISAARGGIKTNWVISMPPGQSGQ
LRPVIALHGKDGNAGMMLDLGVEQGLARLVKEGKPAFAVVGVDGGNTYWH
RRSSGGDSGAMVLDELLPMLTSMGMDTSRVGFLGWSMGGYGALLLGARLG
PARTAGICAISPALFTSFTGSTPGAFDSYDDYVQHSVLGLPALNSIPLRV
DCGTSDRFYFATRQFVNQLHQPPAGSFSPGGHDASYWREQLPGELAWMAS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLRRGCAGNTDRRGIMTPMADLTRRALLRWGAGAGAGAAGVWAFGALVDP
LEPQAAPAPFEPPTAGSSLPTRISGSFISAARGGIKTNWVISMPPGQSGQ
LRPVIALHGKDGNAGMMLDLGVEQGLARLVKEGKPAFAVVGVDGGNTYWH
RRSSGGDSGAMVLDELLPMLTSMGMDTSRVGFLGWSMGGYGALLLGARLG
PARTAGICAISPALFTSFTGSTPGAFDSYDDYVQHSVLGLPALNSIPLRV
DCGTSDRFYFATRQFVNQLHQPPAGSFSPGGHDASYWREQLPGELAWMAS


References
4 more
    Title: The alpha/beta Hydrolase Fold Proteins of Mycobacterium tuberculosis, With Reference to their Contribution to Virulence
    Johnson G
    Ref: Curr Protein Pept Sci, 18:190, 2016 : PubMed

            

    Title: Functional characterization of hypothetical proteins of Mycobacterium tuberculosis with possible esterase/lipase signature: A Cumulative in silico and in vitro approach
    Kumar A, Sharma A, Kaur G, Makkar P, Kaur J
    Ref: J Biomol Struct Dyn, 35:1226, 2016 : PubMed

            

    Title: The complete genome sequence of Mycobacterium bovis
    Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C and Hewinson RG <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:7877, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer