myctu-ephc

 
Mycobacterium tuberculosis, Mycobacterium bovis, Epoxide hydrolase ephc gene Mycobacterium bovis ephC Rv1124

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



 
Sequence
Graphical view for this peptide sequence: myctu-ephc
Colored MSA for Epoxide_hydrolase (raw)
MRAGRGERESTWRTTMAEPHWIDVKGPNGDLKALTWGPAGAPVALCLHGF
PDTAYGWRKVAPRLAESGWHVVAPFMRGYAPSSIPADGSYHVGALMHDAL
RVRSAAGGTERDVIIGHDWGAIAATGLAAMPDSPFAKAVIMSVPPSAAFR
PLGRVPERGRLLRELPHQLLRSWYILYFQLPWLPERSASWVVPLLWRRWS
PGYHAEEDLRHVDAAIGTPEGRRAALGPYRATMRNTRAPADYADLNRLWT
EAPKLPVLYLHGHDDGCATSAFTHWTARVLPAGSEVAVVEHAGHFLQLEQ
PDKIAELIVAFIGSPG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRAGRGERESTWRTTMAEPHWIDVKGPNGDLKALTWGPAGAPVALCLHGF
PDTAYGWRKVAPRLAESGWHVVAPFMRGYAPSSIPADGSYHVGALMHDAL
RVRSAAGGTERDVIIGHDWGAIAATGLAAMPDSPFAKAVIMSVPPSAAFR
PLGRVPERGRLLRELPHQLLRSWYILYFQLPWLPERSASWVVPLLWRRWS
PGYHAEEDLRHVDAAIGTPEGRRAALGPYRATMRNTRAPADYADLNRLWT
EAPKLPVLYLHGHDDGCATSAFTHWTARVLPAGSEVAVVEHAGHFLQLEQ
PDKIAELIVAFIGSPG

Graphical view for this nucleotide DNA sequence (983 bp): myctu-ephc



References
3 more
    Title: Whole genome sequence analysis of Mycobacterium bovis bacillus Calmette-Guerin (BCG) Tokyo 172: a comparative study of BCG vaccine substrains
    Seki M, Honda I, Fujita I, Yano I, Yamamoto S, Koyama A
    Ref: Vaccine, 27:1710, 2009 : PubMed

            

    Title: Genome plasticity of BCG and impact on vaccine efficacy
    Brosch R, Gordon SV, Garnier T, Eiglmeier K, Frigui W, Valenti P, Dos Santos S, Duthoy S, Lacroix C and Cole ST <10 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:5596, 2007 : PubMed

            

    Title: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence
    Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S and Barrell BG <32 more author(s)>
    Ref: Nature, 393:537, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer