Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aedae-ACHE1

Aedes aegypti (Yellowfever mosquito) (Culex aegypti) partial achE1 gene for acetylcholinesterase

Comment
Partial sequence from this gene found in 14 other mosquitos Aedes aegypti (Yellowfever mosquito)(Culex aegypti), Aedes albopictus (Forest day mosquito) AJ438598 Anopheles albimanus (New world malaria mosquito) AJ438608, Anopheles arabiensis (Mosquito) AJ438603, Anopheles darlingi AJ438599, Anopheles funestus AJ438604 Anopheles minimus AJ438601 Anopheles moucheti AJ438602, Anopheles nili AJ438609 Anopheles pseudopunctipennis AJ438605 Anopheles sacharovi AJ438606 Anopheles stephensi (Indo-Pakistan malaria mosquito) AJ438607, Anopheles sundaicus AJ438600 Mori,A., Lobo,N.F., deBruyn,B. and Severson,D.W


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Aedes aegypti
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Culicomorpha: N E > Culicoidea: N E > Culicidae: N E > Culicinae: N E > Aedini: N E > Aedes: N E > Stegomyia: N E > Aedes aegypti: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: aedae-ACHE1
Colored MSA for ACHE (raw)
MEIRGLITRLLGPCHIRHLILCSLGIYSILVQSVHCRHHDIGSSTAHQLG
SKYSQSSSLSSSSQSSSSLVEDPVLNKDSDAFFTPYIGHGDSVRIVDAEL
GTLEREHVHSTTTRRRGLTRRESSSDGTDNDPLLITTDKGKVRGLTLEAP
SGKKVDAWLGIPYAQPPLGPLRFRHPRPVEKWTGVLNATTPPNSCVQIVD
TVFGDFPGATMWNPNTPLSEDCLYINVVVPHPRPKNSAVMLWIFGGGFYS
GTATLDVYDHRTLASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQ
NLALRWVRDNIHKFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAI
LQSGSPTAPWALVSREEATLRALRLAEAVNCPHDATKLTDTVECLRTKDP
NVLVDNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTDILTGSN
TEEGYYFIIYYLTELLRKEEGVTVSREEFLQAVRELNPYVNGAARQAIVF
EYTDWTEPENPNSNRDALDKMVGDYHFTCNVNEFAQRYAEEGNNVYMYLY
THRSKGNPWPRWTGVMHGDEINYVFGEPLNSDLGYMEDEKDFSRKIMRYW
SNFAKTGNPNPSPPNSDFPEWPKHTAHGRHYLELGLNTTYVGRGPRLRQC
AFWKKYLPQLVAATSNLQATPAPSEPCGSSATPYRPLLFLIVSLVLVTCF
KI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEIRGLITRLLGPCHIRHLILCSLGIYSILVQSVHCRHHDIGSSTAHQLG
SKYSQSSSLSSSSQSSSSLVEDPVLNKDSDAFFTPYIGHGDSVRIVDAEL
GTLEREHVHSTTTRRRGLTRRESSSDGTDNDPLLITTDKGKVRGLTLEAP
SGKKVDAWLGIPYAQPPLGPLRFRHPRPVEKWTGVLNATTPPNSCVQIVD
TVFGDFPGATMWNPNTPLSEDCLYINVVVPHPRPKNSAVMLWIFGGGFYS
GTATLDVYDHRTLASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQ
NLALRWVRDNIHKFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAI
LQSGSPTAPWALVSREEATLRALRLAEAVNCPHDATKLTDTVECLRTKDP
NVLVDNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTDILTGSN
TEEGYYFIIYYLTELLRKEEGVTVSREEFLQAVRELNPYVNGAARQAIVF
EYTDWTEPENPNSNRDALDKMVGDYHFTCNVNEFAQRYAEEGNNVYMYLY
THRSKGNPWPRWTGVMHGDEINYVFGEPLNSDLGYMEDEKDFSRKIMRYW
SNFAKTGNPNPSPPNSDFPEWPKHTAHGRHYLELGLNTTYVGRGPRLRQC
AFWKKYLPQLVAATSNLQATPAPSEPCGSSATPYRPLLFLIVSLVLVTCF
KI


References
1 more
    Title: Molecular cloning and characterization of the complete acetylcholinesterase gene (Ace1) from the mosquito Aedes aegypti with implications for comparative genome analysis
    Mori A, Lobo NF, Debruyn B, Severson DW
    Ref: Insect Biochemistry & Molecular Biology, 37:667, 2007 : PubMed

            

    Title: Genome sequence of Aedes aegypti, a major arbovirus vector
    Nene V, Wortman JR, Lawson D, Haas B, Kodira C, Tu ZJ, Loftus B, Xi Z, Megy K and Severson DW <85 more author(s)>
    Ref: Science, 316:1718, 2007 : PubMed

            

    Title: A novel acetylcholinesterase gene in mosquitoes codes for the insecticide target and is non-homologous to the ace gene Drosophila
    Weill M, Fort P, Berthomieu A, Dubois MP, Pasteur N, Raymond M
    Ref: Proc R Soc Lond B Biol Sci, 269:2007, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer