arath-AT3g62590

 
Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress), AT3g62590 F26K9_20 hypothetical 69.4 kda protein

Comment
Trembl Q940L4 is the cDNA: some diff


Relationship
Family Lipase_3
Block L
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : AL162651
3 UniProt : Q940L4, Q9LZK6, D7LT75
3 UniProtTrembl : Q9LZK6, Q940L4, D7LT75
3 Interpro : Q9LZK6, Q940L4, D7LT75
3 Prodom : Q9LZK6, Q940L4, D7LT75
3 Pfam : Q9LZK6, Q940L4, D7LT75
3 PIRSF : Q9LZK6, Q940L4, D7LT75
3 SUPERFAM : Q9LZK6, Q940L4, D7LT75
3 QuickSwissBlast : Q9LZK6, Q940L4, D7LT75
1 Tair database : AT3g62590
 
Sequence
Graphical view for this peptide sequence: arath-AT3g62590
Colored MSA for Lipase_3 (raw)
MEGVFLKMSVVGVSPMIPVGPSSFICAIGGSVEEKSTAASLPRWVSLRRL
RPLEFLRIGGKREEKGTVGSIWKGKRQRSGGGGGGEEDEEEEVAEPKKKE
DLCEECDFCRIDDDDEDEEKEKTVFEFSEMLSKIPVEDAQMFAKLSFLGN
LAYSIPKIKPENLLKYQKLRFVTSSIEKRMSLKVEENNNGEEDEEKKKLI
NPAVAYRIAASAASRLFSHSKSVLPFGSSKRQDNEEASLLATADSVTAVV
AAKEEVKQAVADDLKSNRSPPCEWFVCDDDKSGTRFFFIQGSDSLASWQA
NLLFEPVPFEDLDVLVHRGIYEAAKGIYEQMLPEVHAHLNSRGKNRAFLR
FSGHSLGGSLSLLVNLMLLIRGQVPASSLLPVITFGSPCIMCGGDRLLQK
LGLPKSHLLGISMHRDIVPRAFSCNYPNRAAKLLKALNGNFRNHPCLNNQ
NVLYSPMGKLLILQPSERFSPPHPLLPPGSGLYLLASKNTDETEKSLRAA
KILFFNSPHPLEILSDRRSYGSEGKIKRNHDMSSYLKALRHVIRKELKQM
KAERDQWLRKFFIINILFSGRDSLKLITRFVASRSSQLVIIFFLPIRLLI
MSVYSVVFHHSQAHFSFFK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEGVFLKMSVVGVSPMIPVGPSSFICAIGGSVEEKSTAASLPRWVSLRRL
RPLEFLRIGGKREEKGTVGSIWKGKRQRSGGGGGGEEDEEEEVAEPKKKE
DLCEECDFCRIDDDDEDEEKEKTVFEFSEMLSKIPVEDAQMFAKLSFLGN
LAYSIPKIKPENLLKYQKLRFVTSSIEKRMSLKVEENNNGEEDEEKKKLI
NPAVAYRIAASAASRLFSHSKSVLPFGSSKRQDNEEASLLATADSVTAVV
AAKEEVKQAVADDLKSNRSPPCEWFVCDDDKSGTRFFFIQGSDSLASWQA
NLLFEPVPFEDLDVLVHRGIYEAAKGIYEQMLPEVHAHLNSRGKNRAFLR
FSGHSLGGSLSLLVNLMLLIRGQVPASSLLPVITFGSPCIMCGGDRLLQK
LGLPKSHLLGISMHRDIVPRAFSCNYPNRAAKLLKALNGNFRNHPCLNNQ
NVLYSPMGKLLILQPSERFSPPHPLLPPGSGLYLLASKNTDETEKSLRAA
KILFFNSPHPLEILSDRRSYGSEGKIKRNHDMSSYLKALRHVIRKELKQM
KAERDQWLRKFFIINILFSGRDSLKLITRFVASRSSQLVIIFFLPIRLLI
MSVYSVVFHHSQAHFSFFK

no DNA




References
1 more
    Title: Two Abscisic Acid-Responsive Plastid Lipase Genes Involved in Jasmonic Acid Biosynthesis in Arabidopsis thaliana
    Wang K, Guo Q, Froehlich JE, Hersh HL, Zienkiewicz A, Howe GA, Benning C
    Ref: Plant Cell, 30:1006, 2018 : PubMed

            

    Title: Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana
    Salanoubat M, Lemcke K, Rieger M, Ansorge W, Unseld M, Fartmann B, Valle G, Blocker H, Perez-Alonso M and Tabata S <127 more author(s)>
    Ref: Nature, 408:820, 2000 : PubMed

            

    Title: Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana
    Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL and Venter JC <27 more author(s)>
    Ref: Nature, 402:761, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer