Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacce-BC4730

Bacillus cereus, Bacillus thuringiensis, Bacillus anthracis, Bacillus weihenstephanensis, homoserine o-acetyltransferase (EC 2.3.1.31)

Comment
Other strains: Bacillus cereus (strains ATCC 14579 / DSM 31; ZK / E33L; G9241; ATCC 10987; G9842; BDRD-Cer4; ATCC 14579 / DSM 31; BAG4O-1), Bacillus thuringiensis (serovar israelensis ATCC 35646; subsp. konkukian; Al Hakam), Bacillus anthracis (strain Ames), Bacillus weihenstephanensis KBAB4 AF067645 O85466 Clements et al 3aa diff


Relationship
Family|Homoserine_transacetylase
Block| X
Position in NCBI Life Tree|Bacillus cereus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
L-homoserine
No inhibitor
>3 Genbank links 7 more: CP000001, AF067645, AE017013
>3 UniProt links 6 more: Q632V9, Q3EQU6, Q6HCE9
>3 UniProt links 22 more: Q816T7, Q632V9, O85466
>3 Interpro links 22 more: Q816T7, Q632V9, O85466
>3 Pfam links 22 more: Q816T7, Q632V9, O85466
>3 PIRSF links 22 more: Q816T7, Q632V9, O85466
>3 SUPERFAM links 22 more: Q816T7, Q632V9, O85466
Sequence
Graphical view for this peptide sequence: bacce-BC4730
Colored MSA for Homoserine_transacetylase (raw)
MQIVKKEKFVLKGFTFENGREIPVQMGYETYGTLNRERSNVILVCHYFSA
TSHAAGKYTVHDEESGWWDGLIGPGKAIDTNKYFVICTDNLCNVQVRNPY
VITTGPKSINPETGEEYAMDFPVFTFLDVARMQYELIKGMGISRLHAVIG
PSVGGMIAQQWAVHYPHMVERMIGVITNPQNPIITSVNVAQNAIEAIQLD
PSWKGGKYGEEQPIKGLHLANRMMFMNAFDEHFYEMAFPRNSIEIEPYEK
FSTLTSFEKEINKATYRSIELVDANSWMYTAKAVLLHDIAHGFSSLEESL
SNIEANVLMIPCKQDLLQPSRYNYKMVDILQKQGKYAEVYEIESINGHMA
GAFDIHLFEKKVYEFLNRKVSSFV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQIVKKEKFVLKGFTFENGREIPVQMGYETYGTLNRERSNVILVCHYFSA
TSHAAGKYTVHDEESGWWDGLIGPGKAIDTNKYFVICTDNLCNVQVRNPY
VITTGPKSINPETGEEYAMDFPVFTFLDVARMQYELIKGMGISRLHAVIG
PSVGGMIAQQWAVHYPHMVERMIGVITNPQNPIITSVNVAQNAIEAIQLD
PSWKGGKYGEEQPIKGLHLANRMMFMNAFDEHFYEMAFPRNSIEIEPYEK
FSTLTSFEKEINKATYRSIELVDANSWMYTAKAVLLHDIAHGFSSLEESL
SNIEANVLMIPCKQDLLQPSRYNYKMVDILQKQGKYAEVYEIESINGHMA
GAFDIHLFEKKVYEFLNRKVSSFV


References
5 more
    Title: Identification of anthrax toxin genes in a Bacillus cereus associated with an illness resembling inhalation anthrax
    Hoffmaster AR, Ravel J, Rasko DA, Chapman GD, Chute MD, Marston CK, De BK, Sacchi CT, Fitzgerald C and Fraser CM <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:8449, 2004 : PubMed

            

    Title: Genome sequence of Bacillus cereus and comparative analysis with Bacillus anthracis.
    Ivanova N, Sorokin A, Anderson I, Galleron N, Candelon B, Kapatral V, Bhattacharyya A, Reznik G, Mikhailova N and Kyrpides N <13 more author(s)>
    Ref: Nature, 423:87, 2003 : PubMed

            

    Title: Role of the gerI operon of Bacillus cereus 569 in the response of spores to germinants
    Clements MO, Moir A
    Ref: Journal of Bacteriology, 180:6729, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer