Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-abhd4

Mus musculus (Mouse) abhydrolase domain-containing protein 4 similar to hypothetical protein flj12816

Relationship
Family|CGI-58_ABHD5_ABHD4
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
1 mutation: mouse-abhd4
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: BC017532, AK030250, NM_134076
2 UniProt : Q8VD66, Q3U7M5
>3 UniProt links 1 more: Q8VD66, Q8C0M2, Q99KW5
>3 Interpro links 1 more: Q8VD66, Q8C0M2, Q99KW5
>3 Pfam links 1 more: Q8VD66, Q8C0M2, Q99KW5
>3 PIRSF links 1 more: Q8VD66, Q8C0M2, Q99KW5
>3 SUPERFAM links 1 more: Q8VD66, Q8C0M2, Q99KW5
1 MGD : 1915938
1 ENSEMBL : ENSMUSG00000040997
Sequence
Graphical view for this peptide sequence: mouse-abhd4
Colored MSA for CGI-58_ABHD5_ABHD4 (raw)
MADDLEQQPQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSL
PNQNKIWTVTVSPEQKDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTF
DLLGFGRSSRPTFPRDPEGAEDEFVASIETWRETMGIPTMILLGHSLGGF
LATSYSIKYPERVKHLILVDPWGFPLRPTDPSEIRAPPTWVKAVASVLGR
SNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNP
SGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGANTWIDTSTGKK
VKMQRPDSYVRDMEIEGASHHVYADQPHIFNAVVEEICNSVD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MADDLEQQPQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSL
PNQNKIWTVTVSPEQKDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTF
DLLGFGRSSRPTFPRDPEGAEDEFVASIETWRETMGIPTMILLGHSLGGF
LATSYSIKYPERVKHLILVDPWGFPLRPTDPSEIRAPPTWVKAVASVLGR
SNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCNAQNP
SGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGANTWIDTSTGKK
VKMQRPDSYVRDMEIEGASHHVYADQPHIFNAVVEEICNSVD


References
2 more
    Title: ABHD4 regulates adipocyte differentiation in vitro but does not affect adipose tissue lipid metabolism in mice
    Seramur ME, Sink S, O'Brien Cox A, Furdui CM, Key CC
    Ref: J Lipid Res, :100405, 2023 : PubMed

            

    Title: ABHD4-dependent developmental anoikis safeguards the embryonic brain
    Laszlo ZI, Lele Z, Zoldi M, Miczan V, Mogor F, Simon GM, Mackie K, Kacskovics I, Cravatt BF, Katona I
    Ref: Nat Commun, 11:4363, 2020 : PubMed

            

    Title: Molecular Basis of ABHD5 Lipolysis Activation
    Sanders MA, Zhang H, Mladenovic L, Tseng YY, Granneman JG
    Ref: Sci Rep, 7:42589, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer