Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-mgll

Saccharomyces cerevisiae (Baker's yeast) MGLL Yju3p YKL094W YKL441 Monoglyceride lipase

Comment
Other strains: Saccharomyces cerevisiae (strain YJM789; JAY291; Zymaflore VL3; Lalvin QA23; AWRI796; ATCC 204508 / S288c; FostersO; AWRI1631; RM11-1a; FostersB; VIN 13) (Baker's yeast) Product of gene unknown Yju3p


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 4ZWN, 4ZXF
No kinetic





No Substrate
1 inhbitor:
C18-octadecyl-MAG-like-phosphonate
>3 Genbank links 1 more: X66245, X71133, Z28094
>3 UniProt links 3 more: P28321, A6ZZM3, C7GVL6
2 Structure : 4ZXF, 4ZWN
>3 UniProt links 3 more: P28321, A6ZZM3, C7GVL6
>3 Interpro links 3 more: P28321, A6ZZM3, C7GVL6
>3 Prodom links 3 more: P28321, A6ZZM3, C7GVL6
>3 Pfam links 3 more: P28321, A6ZZM3, C7GVL6
>3 PIRSF links 3 more: P28321, A6ZZM3, C7GVL6
>3 SUPERFAM links 3 more: P28321, A6ZZM3, C7GVL6
1 SGD : S0001577
Sequence
Graphical view for this peptide sequence: yeast-mgll
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MAPYPYKVQTTVPELQYENFDGAKFGYMFWPVQNGTNEVRGRVLLIHGFG
EYTKIQFRLMDHLSLNGYESFTFDQRGAGVTSPGRSKGVTDEYHVFNDLE
HFVEKNLSECKAKGIPLFMWGHSMGGGICLNYACQGKHKNEISGYIGSGP
LIILHPHTMYNKPTQIIAPLLAKFLPRVRIDTGLDLKGITSDKAYRAFLG
SDPMSVPLYGSFRQIHDFMQRGAKLYKNENNYIQKNFAKDKPVVIMHGQD
DTINDPKGSEKFIQDCPSADKELKLYPGARHSIFSLETDEVFNTVFNDMK
QWLDKHTTTEAKP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAPYPYKVQTTVPELQYENFDGAKFGYMFWPVQNGTNEVRGRVLLIHGFG
EYTKIQFRLMDHLSLNGYESFTFDQRGAGVTSPGRSKGVTDEYHVFNDLE
HFVEKNLSECKAKGIPLFMWGHSMGGGICLNYACQGKHKNEISGYIGSGP
LIILHPHTMYNKPTQIIAPLLAKFLPRVRIDTGLDLKGITSDKAYRAFLG
SDPMSVPLYGSFRQIHDFMQRGAKLYKNENNYIQKNFAKDKPVVIMHGQD
DTINDPKGSEKFIQDCPSADKELKLYPGARHSIFSLETDEVFNTVFNDMK
QWLDKHTTTEAKP


References
14 more
    Title: Identification of Yju3p as functional orthologue of mammalian monoglyceride lipase in the yeast Saccharomycescerevisiae
    Heier C, Taschler U, Rengachari S, Oberer M, Wolinski H, Natter K, Kohlwein SD, Leber R, Zimmermann R
    Ref: Biochimica & Biophysica Acta, 1801:1063, 2010 : PubMed

            

    Title: DNA sequence analysis of a 17 kb fragment of yeast chromosome XI physically localizes the MRB1 gene and reveals eight new open reading frames, including a homologue of the KIN1/KIN2 and SNF1 protein kinases
    Pallier C, Valens M, Puzos V, Fukuhara H, Cheret G, Sor F, Bolotin-Fukuhara M
    Ref: Yeast, 9:1149, 1993 : PubMed

            

    Title: Sequence of the novel essential gene YJU2 and two flanking reading frames located within a 3.2 kb EcoRI fragment from chromosome X of Saccharomyces cerevisiae
    Forrova H, Kolarov J, Ghislain M, Goffeau A
    Ref: Yeast, 8:419, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer