arath-T19F11.2

 
Arabidopsis thaliana (Mouse-ear cress), Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) t19f11.2 At3g11620 protein

Comment
very similar to Q9CAW8 F24K9.27 not present any more in ATBase


Relationship
Block X
Arabidopsis thaliana position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : AC009918, AY084726, AK229136
>3 UniProt links 2 more: Q9SRN3, Q9CAW8, Q8LFP3
>3 UniProtTrembl links 2 more: Q9SRN3, Q9CAW8, Q8LFP3
>3 Interpro links 2 more: Q9SRN3, Q9CAW8, Q8LFP3
>3 Prodom links 2 more: Q9SRN3, Q9CAW8, Q8LFP3
>3 Pfam links 2 more: Q9SRN3, Q9CAW8, Q8LFP3
>3 PIRSF links 2 more: Q9SRN3, Q9CAW8, Q8LFP3
>3 SUPERFAM links 2 more: Q9SRN3, Q9CAW8, Q8LFP3
>3 QuickSwissBlast links 2 more: Q9SRN3, Q9CAW8, Q8LFP3
1 Tair database : At3g11620
 
Sequence
Graphical view for this peptide sequence: arath-T19F11.2
Colored MSA for LIDHydrolase (raw)
METQNKLMNETKRHVKSRLCRVSGSMTEMMEIQAENPTFHVLFIPGNPGV
VSFYKDFLESLYEFLGGNASVIAIGQISHTSKDWESGRLFSFQEQIDHKI
DFIRQELESVKVPIILVGHSIGSYISLELLKKFSDKVVYCIGLYPFLTLN
QQSTKQSLIGKLAASSVLSATASFLIASLRLLPMSAARLLVSKSIGASWS
DTAVQATCTHLRQYHTMRNVLFMAKSEFRELAAEPDWDFMRENQSKLAFL
FGIDDHWGPLQLFEEISKQAPHTSLSIERGGHTHGFCCTVAGSAWVAQHV
ATLIKNRFSQLQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

METQNKLMNETKRHVKSRLCRVSGSMTEMMEIQAENPTFHVLFIPGNPGV
VSFYKDFLESLYEFLGGNASVIAIGQISHTSKDWESGRLFSFQEQIDHKI
DFIRQELESVKVPIILVGHSIGSYISLELLKKFSDKVVYCIGLYPFLTLN
QQSTKQSLIGKLAASSVLSATASFLIASLRLLPMSAARLLVSKSIGASWS
DTAVQATCTHLRQYHTMRNVLFMAKSEFRELAAEPDWDFMRENQSKLAFL
FGIDDHWGPLQLFEEISKQAPHTSLSIERGGHTHGFCCTVAGSAWVAQHV
ATLIKNRFSQLQ

no DNA




References
1 more
    Title: Features of Arabidopsis genes and genome discovered using full-length cDNAs
    Alexandrov NN, Troukhan ME, Brover VV, Tatarinova T, Flavell RB, Feldmann KA
    Ref: Plant Mol Biol, 60:69, 2006 : PubMed

            

    Title: Full-length messenger RNA sequences greatly improve genome annotation
    Haas BJ, Volfovsky N, Town CD, Troukhan M, Alexandrov N, Feldmann KA, Flavell RB, White O, Salzberg SL
    Ref: Genome Biol, 3:RESEARCH0029, 2002 : PubMed

            

    Title: Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana
    Salanoubat M, Lemcke K, Rieger M, Ansorge W, Unseld M, Fartmann B, Valle G, Blocker H, Perez-Alonso M and Tabata S <127 more author(s)>
    Ref: Nature, 408:820, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer