Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacan-BA2392

Bacillus anthracis; Bacillus thuringiensis, Bacillus cereus, Bacillus weihenstephanensis, Bacillus mycoides, Proline_iminopeptidase

Comment
Other strains: Bacillus anthracis (strains Ames; A0488; A0193; A0442; A0389; A0465; A0174; Tsiankovskii-I; CDC 684 / NRRL 3495; A0248; H9401; UR-1; BF1; A16R; A16; 8903-G; 9080-G; 52-G; CZC5; SVA11) Bacillus thuringiensis (subsp. konkukian; Al Hakam; serovars (pulsiensis BGSC 4CC1; monterrey BGSC 4AJ1; andalousiensis BGSC 4AW1; pondicheriensis BGSC 4BA1; tochigiensis BGSC 4Y1)subsp. finitimus (strain YBT-020)); Bacillus cereus (W; NVH0597-99; 03BB108; BGSC 6E1; F837/76; AH820; 03BB102; 95/8201; AH621; BDRD-ST196; Rock3-29; Rock1-3; Rock3-28; R309803; AH603; MM3; AH1271; ATCC 10987; ZK; AH1134; var. anthracis (strain CI); ISP3191), Bacillus weihenstephanensis (strain KBAB4), Bacillus mycoides DSM 2048


Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Bacillus anthracis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus anthracis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 49 more: AE017031, AE017355, AHEK01000014
>3 UniProt links 13 more: Q6HIY5, D8GX31, C3GIS3
>3 UniProt links 14 more: Q81QN1, Q6HIY5, D8GX31
>3 Interpro links 14 more: Q81QN1, Q6HIY5, D8GX31
>3 Pfam links 14 more: Q81QN1, Q6HIY5, D8GX31
>3 PIRSF links 14 more: Q81QN1, Q6HIY5, D8GX31
>3 SUPERFAM links 14 more: Q81QN1, Q6HIY5, D8GX31
Sequence
Graphical view for this peptide sequence: bacan-BA2392
Colored MSA for Proline_iminopeptidase (raw)
MKKIAKLIKFIGAITILLLIVALIFPTWTSQIKGQNSISTLEKVEINGSD
HEIMIRGKDKNNPVIIFVHGGPGTSEIPYAQKYQDLLEEKFTVVHYDQRG
SGKSYHFFEDYSNLTSDLLVEDLLAMTDYISKRLGKEKAILIGHSYGTYI
GMQAANKAPEKYEAYVGIGQMSDTLEGEMDSLKFVIDQAENAGNKEEVSY
LNGLTEKIKNGDTYTPRNYVGKYGGTSRLIENPDGDNIGMLLSNEYNLLD
VIRYNVGLSHSQTVLLEKDLKNPLPTKVKKLKLPFYFLMGKYDYNTSFHA
AKTYFDTIEAEQKEFITFEKSAHYPQFEEKEKFYEWMCDTFVK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKIAKLIKFIGAITILLLIVALIFPTWTSQIKGQNSISTLEKVEINGSD
HEIMIRGKDKNNPVIIFVHGGPGTSEIPYAQKYQDLLEEKFTVVHYDQRG
SGKSYHFFEDYSNLTSDLLVEDLLAMTDYISKRLGKEKAILIGHSYGTYI
GMQAANKAPEKYEAYVGIGQMSDTLEGEMDSLKFVIDQAENAGNKEEVSY
LNGLTEKIKNGDTYTPRNYVGKYGGTSRLIENPDGDNIGMLLSNEYNLLD
VIRYNVGLSHSQTVLLEKDLKNPLPTKVKKLKLPFYFLMGKYDYNTSFHA
AKTYFDTIEAEQKEFITFEKSAHYPQFEEKEKFYEWMCDTFVK


References
9 more
    Title: Complete genome sequence of Bacillus thuringiensis serovar finitimus strain YBT-020
    Zhu Y, Shang H, Zhu Q, Ji F, Wang P, Fu J, Deng Y, Xu C, Ye W and Sun M <4 more author(s)>
    Ref: Journal of Bacteriology, 193:2379, 2011 : PubMed

            

    Title: The genome of a Bacillus isolate causing anthrax in chimpanzees combines chromosomal properties of B. cereus with B. anthracis virulence plasmids
    Klee SR, Brzuszkiewicz EB, Nattermann H, Bruggemann H, Dupke S, Wollherr A, Franz T, Pauli G, Appel B and Liesegang H <8 more author(s)>
    Ref: PLoS ONE, 5:e10986, 2010 : PubMed

            

    Title: The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria
    Read TD, Peterson SN, Tourasse N, Baillie LW, Paulsen IT, Nelson KE, Tettelin H, Fouts DE, Eisen JA and Fraser CM <42 more author(s)>
    Ref: Nature, 423:81, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer