Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacan-DHBF

Bacillus anthracis, Bacillus thuringiensis, Bacillus mycoides, Bacillus weihenstephanensis, nonribosomal peptide synthetase dhbf Thioesterase domain

Comment
Other strains: Bacillus anthracis (strains Ames; A0389; CDC 684 / NRRL 3495; A0488; A0248; A0193; A0174; Tsiankovskii-I) Bacillus cereus (strains: 03BB108; var. anthracis CI; W; Q1; G9842; H3081.97; Rock3-42; 03BB102; AH187; m1293; 95/8201; Rock4-2; AH621; Rock3-28; BGSC 6E1; 172560W; AH676; R309803; ATCC 4342; ATCC 10876; MM3; m1550; AH1273; AH1272; B4264; BDRD-ST26; NVH0597-99; AH1271; AH820; BDRD-Cer4; AH603; Rock3-29; AH1134; Rock1-15; F65185; BDRD-ST196; BDRD-ST24; Rock1-3) Bacillus thuringiensis (strains: IBL 4222; IBL 200; Al Hakam; Bt407; BMB171; (subsp. konkukian; finitimus (strain YBT-020)) (serovars: israelensis ATCC 35646; pondicheriensis BGSC 4BA1; tochigiensis BGSC 4Y1; andalousiensis BGSC 4AW1; sotto str. T04001; chinensis CT-43; huazhongensis BGSC 4BD1; kurstaki str. T03a001; pakistani str. T13001; berliner ATCC 10792; monterrey BGSC 4AJ1; thuringiensis str. T01001; pulsiensis BGSC 4CC1)) Bacillus mycoides DSM 2048 Bacillus weihenstephanensis (strain KBAB4) nonribosomal peptide synthetase dhbf Thioesterase domain


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Bacillus anthracis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus anthracis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AE017355, AE017031, AAJM01000612
>3 UniProt links 31 more: Q81QP7, Q6HJ02, Q3EKI9
>3 UniProt links 31 more: Q81QP7, Q6HJ02, Q3EKI9
>3 Interpro links 31 more: Q81QP7, Q6HJ02, Q3EKI9
>3 Pfam links 31 more: Q81QP7, Q6HJ02, Q3EKI9
>3 PIRSF links 31 more: Q81QP7, Q6HJ02, Q3EKI9
>3 SUPERFAM links 31 more: Q81QP7, Q6HJ02, Q3EKI9
Sequence
Graphical view for this peptide sequence: bacan-DHBF
Colored MSA for Thioesterase (raw)
PEFIASASSRGPRTPQEEMLCDLFTEVLSVPQIGIDDGFFDLGGHSLLAV
QLMSRMKEALGVELNIGTLFAAPTVAGLAERLEMGNGQSALDVLLPLRSG
GDQLPLFCVHPAGGLSWCYAGLMKSLGTDYPIYGVQARGIAKNEELPKSL
EEMAADYLKHIREVQPHGPYRLLGWSLGGNVVHAMAAQLQNEGEEVELLV
MLDSYPGHFLPNTEAPTEEEALIALLALGGYDPDNMDGKPLTMESAVEIL
RKDGSALASLEEETILNLKETYVNSVGLLGKYIPKVYNGDILFFRSTVIP
DWFDPISPNTWLNYLDGQIVQYDIDCRHKDLCQPGPLTEIGQVLAKYLQN
KKGVSTV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

PEFIASASSRGPRTPQEEMLCDLFTEVLSVPQIGIDDGFFDLGGHSLLAV
QLMSRMKEALGVELNIGTLFAAPTVAGLAERLEMGNGQSALDVLLPLRSG
GDQLPLFCVHPAGGLSWCYAGLMKSLGTDYPIYGVQARGIAKNEELPKSL
EEMAADYLKHIREVQPHGPYRLLGWSLGGNVVHAMAAQLQNEGEEVELLV
MLDSYPGHFLPNTEAPTEEEALIALLALGGYDPDNMDGKPLTMESAVEIL
RKDGSALASLEEETILNLKETYVNSVGLLGKYIPKVYNGDILFFRSTVIP
DWFDPISPNTWLNYLDGQIVQYDIDCRHKDLCQPGPLTEIGQVLAKYLQN
KKGVSTV


References
6 more
    Title: Genomic characterization of the Bacillus cereus sensu lato species: backdrop to the evolution of Bacillus anthracis
    Zwick ME, Joseph SJ, Didelot X, Chen PE, Bishop-Lilly KA, Stewart AC, Willner K, Nolan N, Lentz S and Read TD <4 more author(s)>
    Ref: Genome Res, 22:1512, 2012 : PubMed

            

    Title: Complete genome sequence of Bacillus thuringiensis mutant strain BMB171
    He J, Shao X, Zheng H, Li M, Wang J, Zhang Q, Li L, Liu Z, Sun M and Yu Z <1 more author(s)>
    Ref: Journal of Bacteriology, 192:4074, 2010 : PubMed

            

    Title: The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria
    Read TD, Peterson SN, Tourasse N, Baillie LW, Paulsen IT, Nelson KE, Tettelin H, Fouts DE, Eisen JA and Fraser CM <42 more author(s)>
    Ref: Nature, 423:81, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer