Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacce-BC1788

Bacillus cereus, Bacillus weihenstephanensis, Bacillus thuringiensis, Bacillus anthracis, lysophospholipase l2 (EC 3.1.1.5)

Comment
Other strains: Bacillus cereus (ATCC 14579 / DSM 31; G9241; ZK; ATCC 10987; AH676; BDRD-ST24; BDRD-Cer4; B4264; Rock4-18; m1550; ATCC 10876; Rock3-28; ATCC 14579 / DSM 31; Rock1-15; Rock1-3; 172560W; Rock3-29; ATCC 4342; Q1; m1293; Rock3-42; 95/8201; W; AH820; BGSC 6E1; 03BB108; 03BB102; var. anthracis (strain CI)), Bacillus thuringiensis (BMB171; Bt407; Al Hakam; subsp. konkukian; serovars; (chinensis CT-43; thuringiensis T01001; pakistani T13001; sotto T04001, berliner ATCC 10792, israelensis ATCC 35646; tochigiensis BGSC 4Y1; huazhongensis BGSC 4BD1; pulsiensis BGSC 4CC1; pondicheriensis BGSC 4BA1; andalousiensis BGSC 4AW1; monterrey BGSC 4AJ1)), Bacillus weihenstephanensis KBAB4, Bacillus anthracis (strains Ames; CDC 684 / NRRL 3495; A0465; A0488; A0248; Tsiankovskii-I; A0389; A0174; A0442; A0193) Bacillus weihenstephanensis KBAB4


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Bacillus cereus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 5 more: CP000001, AE017003, AAOY01000007
>3 UniProt links 23 more: Q81F19, Q63CU6, Q6HK93
>3 UniProt links 23 more: Q81F19, Q63CU6, Q6HK93
>3 Interpro links 23 more: Q81F19, Q63CU6, Q6HK93
>3 Pfam links 23 more: Q81F19, Q63CU6, Q6HK93
>3 PIRSF links 23 more: Q81F19, Q63CU6, Q6HK93
>3 SUPERFAM links 23 more: Q81F19, Q63CU6, Q6HK93
Sequence
Graphical view for this peptide sequence: bacce-BC1788
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MNVQESFVTALDGSEIYLRKWLPEGDPRGIIQIAHGMTEHAGVYTEFVDA
LLEAGYGVYAHDHKGHGKTVKKEEDYGHFEPNIGWNQVVSDVIFVSEKIK
EEQSSPLFLLGHSMGSFLSRRAVQLRGELYDGFLISGTGGNPGLLGAIGH
KVATIEMKLRGAKTKSPMLNFLSFGNFNSNFKPNRTKFDWLSSDNNQVDK
YIADPLCGFICTTSFYRELFSGVLEVNKLEEYKKTPKNLPIHIFSGDRDP
VGDMGKGVKEVYENYKKCGVKDVTLRLYENGRHEMFHEVNKDEVFKDLIS
WLDAHNK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNVQESFVTALDGSEIYLRKWLPEGDPRGIIQIAHGMTEHAGVYTEFVDA
LLEAGYGVYAHDHKGHGKTVKKEEDYGHFEPNIGWNQVVSDVIFVSEKIK
EEQSSPLFLLGHSMGSFLSRRAVQLRGELYDGFLISGTGGNPGLLGAIGH
KVATIEMKLRGAKTKSPMLNFLSFGNFNSNFKPNRTKFDWLSSDNNQVDK
YIADPLCGFICTTSFYRELFSGVLEVNKLEEYKKTPKNLPIHIFSGDRDP
VGDMGKGVKEVYENYKKCGVKDVTLRLYENGRHEMFHEVNKDEVFKDLIS
WLDAHNK


References
7 more
    Title: Identification of anthrax toxin genes in a Bacillus cereus associated with an illness resembling inhalation anthrax
    Hoffmaster AR, Ravel J, Rasko DA, Chapman GD, Chute MD, Marston CK, De BK, Sacchi CT, Fitzgerald C and Fraser CM <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 101:8449, 2004 : PubMed

            

    Title: Genome sequence of Bacillus cereus and comparative analysis with Bacillus anthracis.
    Ivanova N, Sorokin A, Anderson I, Galleron N, Candelon B, Kapatral V, Bhattacharyya A, Reznik G, Mikhailova N and Kyrpides N <13 more author(s)>
    Ref: Nature, 423:87, 2003 : PubMed

            

    Title: The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria
    Read TD, Peterson SN, Tourasse N, Baillie LW, Paulsen IT, Nelson KE, Tettelin H, Fouts DE, Eisen JA and Fraser CM <42 more author(s)>
    Ref: Nature, 423:81, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer