myctu-RV0774C

 
Mycobacterium tuberculosis and Mycobacterium bovis hypothetical 31.7 kda protein cy369.19c MT0798 RV0774C

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block X
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: BX248336, Z80226, BX842574
2 UniProt : P71829, A5U0G2
2 UniProtTrembl : P71829, A5U0G2
2 Interpro : P71829, A5U0G2
2 Prodom : P71829, A5U0G2
2 Pfam : P71829, A5U0G2
2 PIRSF : P71829, A5U0G2
2 SUPERFAM : P71829, A5U0G2
2 QuickSwissBlast : P71829, A5U0G2
 
Sequence
Graphical view for this peptide sequence: myctu-RV0774C
Colored MSA for A85-Feruloyl-Esterase (raw)
MPIRPNVHGMMARMPELSRRAVLGLGAGTVLGATSAYAIDMLLQPRTSHA
APAAAIGTNVPLAPTPALDPAPPAQAAPTMSTGSFVSAARAGKMTNWAIA
RPPGQTQALRPVIALHGLGGSASAVMDGGVEQGLAQAVNAGLPPFAVVSV
DGGSSYWHQRASGEDAGAMVLNELIPLLDTQRLDTSRVAFLGWSMGGYGA
LLLGSRLGPARTAAICAVSPALWLSAGSVAPGSFDGPDDWSANSVFGLPA
LGSIPIRVDCGNSDPFYAATKQFVAQLPHPPAGGFSPGGHNGGFWSAQLP
AELTWFAPLLTG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPIRPNVHGMMARMPELSRRAVLGLGAGTVLGATSAYAIDMLLQPRTSHA
APAAAIGTNVPLAPTPALDPAPPAQAAPTMSTGSFVSAARAGKMTNWAIA
RPPGQTQALRPVIALHGLGGSASAVMDGGVEQGLAQAVNAGLPPFAVVSV
DGGSSYWHQRASGEDAGAMVLNELIPLLDTQRLDTSRVAFLGWSMGGYGA
LLLGSRLGPARTAAICAVSPALWLSAGSVAPGSFDGPDDWSANSVFGLPA
LGSIPIRVDCGNSDPFYAATKQFVAQLPHPPAGGFSPGGHNGGFWSAQLP
AELTWFAPLLTG

no DNA




References
6 more
    Title: The alpha/beta Hydrolase Fold Proteins of Mycobacterium tuberculosis, With Reference to their Contribution to Virulence
    Johnson G
    Ref: Curr Protein Pept Sci, 18:190, 2016 : PubMed

            

    Title: Rv0774c, an iron stress inducible, extracellular esterase is involved in immune-suppression associated with altered cytokine and TLR2 expression
    Kumar A, Singh SM, Singh R, Kaur J
    Ref: Int J Med Microbiol, 307:126, 2017 : PubMed

            

    Title: Functional characterization of hypothetical proteins of Mycobacterium tuberculosis with possible esterase/lipase signature: A Cumulative in silico and in vitro approach
    Kumar A, Sharma A, Kaur G, Makkar P, Kaur J
    Ref: J Biomol Struct Dyn, 35:1226, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer