drome-MESK2

 
Drosophila melanogaster (Fruit fly) D. simulans; D. ficusphila; D. erecta; D. yakuba; D. sechellia; D. ananassae; D.virilis; D. willistoni; D. mojavensis; D. pseudoobscura, misexpression suppressor of ksr cg15668 protein

Comment
Q9GU49 Q9W2G4 Q9GU50 Q9I7V6 Q9I7V7 alternative splicing Other strains: Drosophila simulans; Drosophila ficusphila; Drosophila erecta; Drosophila yakuba; Drosophila sechellia; Drosophila ananassae; Drosophila virilis; Drosophila willistoni; Drosophila mojavensis; Drosophila pseudoobscura pseudoobscura


Relationship
Family Ndr_family
Block X
Drosophila melanogaster position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 59 more: BT001416, AF195793, AF195792
>3 UniProt links 8 more: Q7KVN1, Q9GU49, Q9I7V6
>3 UniProtTrembl links 58 more: Q9GU49, Q9GU50, Q9I7V6
>3 Interpro links 58 more: Q9GU49, Q9GU50, Q9I7V6
>3 Prodom links 58 more: Q9GU49, Q9GU50, Q9I7V6
>3 Pfam links 58 more: Q9GU49, Q9GU50, Q9I7V6
>3 PIRSF links 58 more: Q9GU49, Q9GU50, Q9I7V6
>3 SUPERFAM links 58 more: Q9GU49, Q9GU50, Q9I7V6
>3 QuickSwissBlast links 58 more: Q9GU49, Q9GU50, Q9I7V6
1 FlyBase : 0043070
 
Sequence
Graphical view for this peptide sequence: drome-MESK2
Colored MSA for Ndr_family (raw)
MPQSEGGYVSLPAVNGNGGAIYQSTTEPTAPPSVFASVKRAIGQAIKSSP
TDSEELLRSDRLPVIVGGSRISFRDRDKSGKTLTTKMPSAPTHTAEEAHL
LGTMPVDPMDDIELRSVQLQFPNARGSILEACEQRRVPTDKGDVHVAIQG
DTAKPAIITYHDLGLNYATSFAGFFNFPVMRGLLENFCVYHVTAPGQEEG
APTLPEDYVYPTMDDLAAQLLFVLSHFGLKSVIGFGVGAGANILARFAHA
HPDKVGALCLINCVSTQSGWIEWGYQSFNARFLRTKGMTQGVIDYLMWHH
FGRNPEERNHDLVQMYKQHFERGVNPTNLAMLINAYIHRNDLHLARTPPG
TPGSETAATTLKMPVINITGSLSPHVDDTVTFNGRLDPTNSSWMKISDCA
LVLEEQPAKLAEAFRLFLQGEGYVSEKPQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPQSEGGYVSLPAVNGNGGAIYQSTTEPTAPPSVFASVKRAIGQAIKSSP
TDSEELLRSDRLPVIVGGSRISFRDRDKSGKTLTTKMPSAPTHTAEEAHL
LGTMPVDPMDDIELRSVQLQFPNARGSILEACEQRRVPTDKGDVHVAIQG
DTAKPAIITYHDLGLNYATSFAGFFNFPVMRGLLENFCVYHVTAPGQEEG
APTLPEDYVYPTMDDLAAQLLFVLSHFGLKSVIGFGVGAGANILARFAHA
HPDKVGALCLINCVSTQSGWIEWGYQSFNARFLRTKGMTQGVIDYLMWHH
FGRNPEERNHDLVQMYKQHFERGVNPTNLAMLINAYIHRNDLHLARTPPG
TPGSETAATTLKMPVINITGSLSPHVDDTVTFNGRLDPTNSSWMKISDCA
LVLEEQPAKLAEAFRLFLQGEGYVSEKPQ

no DNA




References
    Title: The genome sequence of Drosophila melanogaster
    Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA and Venter JC <185 more author(s)>
    Ref: Science, 287:2185, 2000 : PubMed

            

    Title: A misexpression screen identifies genes that can modulate RAS1 pathway signaling in Drosophila melanogaster
    Huang AM, Rubin GM
    Ref: Genetics, 156:1219, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer