drome-este6

Drosophila melanogaster (Fruit fly) gene for carboxylesterase 6 and P the odorant degrading enzyme

Comment

Nucleotide sequence of the Celera sequence differs from the published sequence for this transcript || numerous other strain see the tree display || KEIVLLN GLS replaces TVHGDDYFLIFENFVRDVEMRPDEQIISRNFINMLADFASSDNGSLKYGECDFKDNVGSEKFQLLAIYIDGCQNRQHVEFP at the C-term of Q8SWT4 Stappleton et al. (genbank numbers for numerous strains: AE003542, AAB46703, U57485, AF147095, AF147096, AF147097, AF147098, AF147099, AF147100, AF147101, AF147102, AF217624, AF217625, AF217626, AF217627, AF217628, AF217629, AF217630, AF217631, AF217632, AF217633, AF217634, AF217635, AF217636, AF217637, AF217638, AF217639, AF217640, AF217641, AF217642, AF217643, AF217644, U57474, U57475, U57476, U57477, U57478, U57479, U57480, U57481, U57482, U57483, U57484, U57486, U57487, U57488, DQ500558, DQ500562, DQ500563, DQ500638, DQ500639, DQ500445, DQ500446, DQ500447, DQ500448, DQ500450, DQ500456, DQ500458, DQ500461, DQ500462, DQ500464, DQ500465, DQ500468, DQ500469, DQ500492, DQ500498, DQ500502, DQ500509, DQ500518, DQ500525, DQ500527, DQ500531, DQ500535, DQ500540, DQ500542, DQ500553, DQ500612, DQ500613, DQ500621, DQ500623, DQ500626, DQ500631, DQ500645, DQ500656, DQ500657, DQ500658, DQ500663, DQ500664, DQ500668, DQ500669, DQ500672, DQ500673, DQ500674, DQ500675, DQ500676, DQ500681, DQ500686, DQ500690, DQ500691, DQ500692, DQ500696, DQ500707, DQ500711, DQ500712, DQ500731, DQ500733, DQ500738, DQ500475, DQ500480, DQ500496, DQ500503, DQ500504, DQ500505, DQ500507, DQ500517, DQ500520, DQ500522, DQ500524, DQ500526, DQ500566, DQ500567, DQ500569, DQ500570, DQ500572, DQ500575, DQ500580, DQ500581, DQ500582, DQ500583, DQ500586, DQ500587, DQ500590, DQ500595, DQ500596, DQ500597, DQ500599, DQ500605, DQ500607, DQ500608, DQ500619, DQ500641, DQ500647, DQ500649, DQ500652, DQ500655DQ500555, DQ500478, DQ500479, DQ500482, DQ500510, DQ500523, DQ500529, DQ500568, DQ500571, DQ500574, DQ500601, DQ500604, DQ500609, DQ500642, DQ500643, DQ500654, DQ500449, DQ500452, DQ500485, DQ500487, DQ500508, DQ500533, DQ500539, DQ500543, DQ500549, DQ500550, DQ500552, DQ500592, DQ500610, DQ500662, DQ500697, DQ500714, DQ500726, DQ500727, DQ500729, DQ500470, DQ500471, DQ500472, DQ500494, DQ500495, DQ500559, DQ500560, DQ500561, DQ500637, DQ500640, DQ500709, DQ500710, DQ500444, DQ500451, DQ500455, DQ500457, DQ500459, DQ500460, DQ500463, DQ500466, DQ500467, DQ500486, DQ500488, DQ500489, DQ500491, DQ500493, DQ500499, DQ500501, DQ500506, DQ500519, DQ500530, DQ500532, DQ500536, DQ500537, DQ500538, DQ500541, DQ500544, DQ500545, DQ500546, DQ500547, DQ500548, DQ500551, DQ500554, DQ500556, DQ500557, DQ500584, DQ500616, DQ500624, DQ500625, DQ500628, DQ500629, DQ500630, DQ500632, DQ500633, DQ500634, DQ500635, DQ500636, DQ500653, DQ500659, DQ500660, DQ500661, DQ500665, DQ500666, DQ500667, DQ500671, DQ500677, DQ500678, DQ500680, DQ500683, DQ500684, DQ500687, DQ500688, DQ500689, DQ500693, DQ500695, DQ500698, DQ500699, DQ500700, DQ500701, DQ500702, DQ500703, DQ500704, DQ500705, DQ500706, DQ500708, DQ500713, DQ500715, DQ500716, DQ500717, DQ500718, DQ500719, DQ500720, DQ500721, DQ500722, DQ500723, DQ500724, DQ500725, DQ500728, DQ500730, DQ500732, DQ500734, DQ500735, DQ500736, DQ500737, DQ500739, DQ500740, DQ500741, DQ500473, DQ500474, DQ500476, DQ500477, DQ500481, DQ500483, DQ500500, DQ500511, DQ500512, DQ500513, DQ500514, DQ500515, DQ500516, DQ500521, DQ500528, DQ500565, DQ500573, DQ500576, DQ500577, DQ500578, DQ500585, DQ500588, DQ500589, DQ500591, DQ500593, DQ500594, DQ500598, DQ500602, DQ500606, DQ500611, DQ500615, DQ500617, DQ500618, DQ500620, DQ500622, DQ500627, DQ500644, DQ500648, DQ500650, DQ500651, DQ500453, DQ500454, DQ500490, DQ500534, DQ500670, DQ500679, DQ500682, DQ500685, DQ500694, DQ500484, DQ500497, DQ500564, DQ500579, DQ500600, DQ500603, DQ500614, DQ500646, AY095091, AY247673, AY247674, AY247675, AY247676, AY247677, AY247713, AY247667, AY247669, AY247664, AY247671, AY247683, AY247684, AY247685, AY247686, AY247687, AY247712, AY247711, AY247710, AY247709, AY247708, AY247707, AY247706, AY247705, AY247704, AY247702, AY247700, AY247682, AY247666, AY247665

Relationship

Family : Carb_B_Arthropoda

Block : C

Position in NCBI Life Tree : Drosophila melanogaster

(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)

> cellular organisms N E > Eukaryota N E > Opisthokonta N E > Metazoa N E > Eumetazoa N E > Bilateria N E > Protostomia N E > Ecdysozoa N E > Panarthropoda N E > Arthropoda N E > Mandibulata N E > Pancrustacea N E > Hexapoda N E > Insecta N E > Dicondylia N E > Pterygota N E > Neoptera N E > Holometabola N E > Diptera N E > Brachycera N E > Muscomorpha N E > Eremoneura N E > Cyclorrhapha N E > Schizophora N E > Acalyptratae N E > Ephydroidea N E > Drosophilidae N E > Drosophilinae N E > Drosophilini N E > Drosophila [fruit fly, genus] N E > Sophophora N E > melanogaster group N E > melanogaster subgroup N E > Drosophila melanogaster N E

Molecular evidence

No mutation

No kinetic

No disease

No substrate

Sequence

Peptide

MNYVGLGLII VLSCLWLGSN ASDTDDPLLV QLPQGKLRGR DNGSYYSYES IPYAEPPTGD LRFEAPEPYK QKWSDIFDAT KTPVACLQWD QFTPGANKLV GEEDCLTVSV YKPKNSKRNS FPVVAHIHGG AFMFGAAWQN GHENVMREGK FILVKISYRL GPLGFVSTGD RDLPGNYGLK DQRLALKWIK QNIASFGGEP QNVLLVGHSA GGASVHLQML REDFGQLARA AFSFSGNALD PWVIQKGARG RAFELGRNVG CESAEDSTSL KKCLKSKPAS ELVTAVRKFL IFSYVPFAPF SPVLEPSDAP DAIITQDPRD VIKSGKFGQV PWAVSYVTED GGYNAALLLK ERKSGIVIDD LNERWLELAP YLLFYRDTKT KKDMDDYSRK IKQEYIGNQR FDIESYSELQ RLFTDILFKN STQESLDLHR KYGKSPAYAY VYDNPAEKGI AQVLANRTDY DFGTVHGDDY FLIFENFVRD VEMRPDEQII SRNFINMLAD FASSDNGSLK YGECDFKDNV GSEKFQLLAI YIDGCQNRQH VEFP

References (12)

Title : A Superfamily-wide Activity Atlas of Serine Hydrolases in Drosophila melanogaster - Kumar_2021_Biochemistry_60_1312
Author(s) : Kumar K , Mhetre A , Ratnaparkhi GS , Kamat SS
Ref : Biochemistry , 60 :1312 , 2021
Abstract :
PubMedSearch : Kumar_2021_Biochemistry_60_1312
PubMedID: 33827210
Gene_locus related to this paper: drome-1vite , drome-2vite , drome-3vite , drome-ACHE , drome-aes01 , drome-aes02 , drome-aes03 , drome-aes04 , drome-aes05 , drome-aes06 , drome-aes08 , drome-aes09 , drome-aes10 , drome-CG1882 , drome-CG2493 , drome-CG3160 , drome-CG3523 , drome-CG3524 , drome-CG4267 , drome-CG4851 , drome-CG4979 , drome-CG5355 , drome-CG5966 , drome-CG6113 , drome-CG6271 , drome-CG6283 , drome-CG6295 , drome-CG6296 , drome-CG8424 , drome-CG8425 , drome-CG9186 , drome-CG9542 , drome-CG9858 , drome-CG11034 , drome-CG11055 , drome-CG12108 , drome-CG15101 , drome-CG15102 , drome-CG15106 , drome-CG17097 , drome-CG17101 , drome-CG17192 , drome-CG17374 , drome-CG18815 , drome-dnlg1 , drome-est6p , drome-EST23aes07 , drome-este4 , drome-este6 , drome-KRAKEN , drome-OME , harsa-e2bfn3

Title : Molecular basis for the behavioral effects of the odorant degrading enzyme Esterase 6 in Drosophila - Younus_2017_Sci.Rep_7_46188
Author(s) : Younus F , Fraser NJ , Coppin CW , Liu JW , Correy GJ , Chertemps T , Pandey G , Maibeche M , Jackson CJ , Oakeshott JG
Ref : Sci Rep , 7 :46188 , 2017
Abstract :
PubMedSearch : Younus_2017_Sci.Rep_7_46188
PubMedID: 28393888
Gene_locus related to this paper: drome-este6

Title : An antennal carboxylesterase from , esterase 6, is a candidate odorant-degrading enzyme toward food odorants - Chertemps_2015_Front.Physiol_6_315
Author(s) : Chertemps T , Younus F , Steiner C , Durand N , Coppin CW , Pandey G , Oakeshott JG , Maibeche M
Ref : Front Physiol , 6 :315 , 2015
Abstract :
PubMedSearch : Chertemps_2015_Front.Physiol_6_315
PubMedID: 26594178
Gene_locus related to this paper: drome-este6

Title : Functional fat body proteomics and gene targeting reveal in vivo functions of Drosophila melanogaster a-Esterase-7 - Birner-Gruenberger_2012_Insect.Biochem.Mol.Biol_42_220
Author(s) : Birner-Gruenberger R , Bickmeyer I , Lange J , Hehlert P , Hermetter A , Kollroser M , Rechberger GN , Kuhnlein RP
Ref : Insect Biochemistry & Molecular Biology , 42 :220 , 2012
Abstract :
PubMedSearch : Birner-Gruenberger_2012_Insect.Biochem.Mol.Biol_42_220
PubMedID: 22198472
Gene_locus related to this paper: drome-aes02 , drome-aes05 , drome-CG1882 , drome-CG2059 , drome-CG5355 , drome-CG8425 , drome-CG18815 , drome-EST23aes07 , drome-este6

Title : Latitudinal clines for nucleotide polymorphisms in the Esterase 6 gene of Drosophila melanogaster - Coppin_2007_Genetica_129_259
Author(s) : Coppin CW , Odgers WA , Oakeshott JG
Ref : Genetica , 129 :259 , 2007
Abstract :
PubMedSearch : Coppin_2007_Genetica_129_259
PubMedID: 16955332
Gene_locus related to this paper: drome-este6 , drosi-este6

Title : DNA polymorphism in the beta-Esterase gene cluster of Drosophila melanogaster - Balakirev_2003_Genetics_164_533
Author(s) : Balakirev ES , Chechetkin VR , Lobzin VV , Ayala FJ
Ref : Genetics , 164 :533 , 2003
Abstract :
PubMedSearch : Balakirev_2003_Genetics_164_533
PubMedID: 12807774
Gene_locus related to this paper: drome-este6

Title : Genetic polymorphism at two linked loci, Sod and Est-6, in Drosophila melanogaster - Ayala_2002_Gene_300_19
Author(s) : Ayala FJ , Balakirev ES , Saez AG
Ref : Gene , 300 :19 , 2002
Abstract :
PubMedSearch : Ayala_2002_Gene_300_19
PubMedID: 12468082
Gene_locus related to this paper: drome-este6

Title : Molecular evolution of the Est-6 gene in Drosophila melanogaster: contrasting patterns of DNA variability in adjacent functional regions - Balakirev_2002_Gene_288_167
Author(s) : Balakirev ES , Balakirev EI , Ayala FJ
Ref : Gene , 288 :167 , 2002
Abstract :
PubMedSearch : Balakirev_2002_Gene_288_167
PubMedID: 12034506
Gene_locus related to this paper: drome-este6

Title : The genome sequence of Drosophila melanogaster - Adams_2000_Science_287_2185
Author(s) : Adams MD , Celniker SE , Holt RA , Evans CA , Gocayne JD , Amanatides PG , Scherer SE , Li PW , Hoskins RA , Galle RF , George RA , Lewis SE , Richards S , Ashburner M , Henderson SN , Sutton GG , Wortman JR , Yandell MD , Zhang Q , Chen LX , Brandon RC , Rogers YH , Blazej RG , Champe M , Pfeiffer BD , Wan KH , Doyle C , Baxter EG , Helt G , Nelson CR , Gabor GL , Abril JF , Agbayani A , An HJ , Andrews-Pfannkoch C , Baldwin D , Ballew RM , Basu A , Baxendale J , Bayraktaroglu L , Beasley EM , Beeson KY , Benos PV , Berman BP , Bhandari D , Bolshakov S , Borkova D , Botchan MR , Bouck J , Brokstein P , Brottier P , Burtis KC , Busam DA , Butler H , Cadieu E , Center A , Chandra I , Cherry JM , Cawley S , Dahlke C , Davenport LB , Davies P , de Pablos B , Delcher A , Deng Z , Mays AD , Dew I , Dietz SM , Dodson K , Doup LE , Downes M , Dugan-Rocha S , Dunkov BC , Dunn P , Durbin KJ , Evangelista CC , Ferraz C , Ferriera S , Fleischmann W , Fosler C , Gabrielian AE , Garg NS , Gelbart WM , Glasser K , Glodek A , Gong F , Gorrell JH , Gu Z , Guan P , Harris M , Harris NL , Harvey D , Heiman TJ , Hernandez JR , Houck J , Hostin D , Houston KA , Howland TJ , Wei MH , Ibegwam C , Jalali M , Kalush F , Karpen GH , Ke Z , Kennison JA , Ketchum KA , Kimmel BE , Kodira CD , Kraft C , Kravitz S , Kulp D , Lai Z , Lasko P , Lei Y , Levitsky AA , Li J , Li Z , Liang Y , Lin X , Liu X , Mattei B , McIntosh TC , McLeod MP , McPherson D , Merkulov G , Milshina NV , Mobarry C , Morris J , Moshrefi A , Mount SM , Moy M , Murphy B , Murphy L , Muzny DM , Nelson DL , Nelson DR , Nelson KA , Nixon K , Nusskern DR , Pacleb JM , Palazzolo M , Pittman GS , Pan S , Pollard J , Puri V , Reese MG , Reinert K , Remington K , Saunders RD , Scheeler F , Shen H , Shue BC , Siden-Kiamos I , Simpson M , Skupski MP , Smith T , Spier E , Spradling AC , Stapleton M , Strong R , Sun E , Svirskas R , Tector C , Turner R , Venter E , Wang AH , Wang X , Wang ZY , Wassarman DA , Weinstock GM , Weissenbach J , Williams SM , WoodageT , Worley KC , Wu D , Yang S , Yao QA , Ye J , Yeh RF , Zaveri JS , Zhan M , Zhang G , Zhao Q , Zheng L , Zheng XH , Zhong FN , Zhong W , Zhou X , Zhu S , Zhu X , Smith HO , Gibbs RA , Myers EW , Rubin GM , Venter JC
Ref : Science , 287 :2185 , 2000
Abstract :
PubMedSearch : Adams_2000_Science_287_2185
PubMedID: 10731132
Gene_locus related to this paper: drome-1vite , drome-2vite , drome-3vite , drome-a1z6g9 , drome-abhd2 , drome-ACHE , drome-b6idz4 , drome-BEM46 , drome-CG5707 , drome-CG5704 , drome-CG1309 , drome-CG1882 , drome-CG1986 , drome-CG2059 , drome-CG2493 , drome-CG2528 , drome-CG2772 , drome-CG3160 , drome-CG3344 , drome-CG3523 , drome-CG3524 , drome-CG3734 , drome-CG3739 , drome-CG3744 , drome-CG3841 , drome-CG4267 , drome-CG4382 , drome-CG4390 , drome-CG4572 , drome-CG4582 , drome-CG4851 , drome-CG4979 , drome-CG5068 , drome-CG5162 , drome-CG5355 , drome-CG5377 , drome-CG5397 , drome-CG5412 , drome-CG5665 , drome-CG5932 , drome-CG5966 , drome-CG6018 , drome-CG6113 , drome-CG6271 , drome-CG6283 , drome-CG6295 , drome-CG6296 , drome-CG6414 , drome-CG6431 , drome-CG6472 , drome-CG6567 , drome-CG6675 , drome-CG6753 , drome-CG6847 , drome-CG7329 , drome-CG7367 , drome-CG7529 , drome-CG7632 , drome-CG8058 , drome-CG8093 , drome-CG8233 , drome-CG8424 , drome-CG8425 , drome-CG9059 , drome-CG9186 , drome-CG9287 , drome-CG9289 , drome-CG9542 , drome-CG9858 , drome-CG9953 , drome-CG9966 , drome-CG10116 , drome-CG10163 , drome-CG10175 , drome-CG10339 , drome-CG10357 , drome-CG10982 , drome-CG11034 , drome-CG11055 , drome-CG11309 , drome-CG11319 , drome-CG11406 , drome-CG11598 , drome-CG11600 , drome-CG11608 , drome-CG11626 , drome-CG11935 , drome-CG12108 , drome-CG12869 , drome-CG13282 , drome-CG13562 , drome-CG13772 , drome-CG14034 , drome-nlg3 , drome-CG14717 , drome-CG15101 , drome-CG15102 , drome-CG15106 , drome-CG15111 , drome-CG15820 , drome-CG15821 , drome-CG15879 , drome-CG17097 , drome-CG17099 , drome-CG17101 , drome-CG17191 , drome-CG17192 , drome-CG17292 , drome-CG18258 , drome-CG18284 , drome-CG18301 , drome-CG18302 , drome-CG18493 , drome-CG18530 , drome-CG18641 , drome-CG18815 , drome-CG31089 , drome-CG31091 , drome-CG32333 , drome-CG32483 , drome-CG33174 , drome-dnlg1 , drome-este4 , drome-este6 , drome-GH02384 , drome-GH02439 , drome-glita , drome-KRAKEN , drome-lip1 , drome-LIP2 , drome-lip3 , drome-MESK2 , drome-nrtac , drome-OME , drome-q7k274 , drome-Q9VJN0 , drome-Q8IP31 , drome-q9vux3

Title : Molecular evolution of two linked genes, Est-6 and Sod, in Drosophila melanogaster - Balakirev_1999_Genetics_153_1357
Author(s) : Balakirev ES , Balakirev EI , Rodriguez-Trelles F , Ayala FJ
Ref : Genetics , 153 :1357 , 1999
Abstract :
PubMedSearch : Balakirev_1999_Genetics_153_1357
PubMedID: 10545464
Gene_locus related to this paper: drome-este6

Title : Molecular analysis of duplicated esterase genes in Drosophila melanogaster - Collet_1990_Mol.Biol.Evol_7_9
Author(s) : Collet C , Nielsen KM , Russell RJ , Karl M , Oakeshott JG , Richmond RC
Ref : Molecular Biology Evolution , 7 :9 , 1990
Abstract :
PubMedSearch : Collet_1990_Mol.Biol.Evol_7_9
PubMedID: 2105433
Gene_locus related to this paper: drome-est6p , drome-este6

Title : Molecular cloning and characterization of esterase-6, a serine hydrolase of Drosophila - Oakeshott_1987_Proc.Natl.Acad.Sci.U.S.A_84_3359
Author(s) : Oakeshott JG , Collet C , Phillis RW , Nielsen KM , Russell RJ , Chambers GK , Ross V , Richmond RC
Ref : Proc Natl Acad Sci U S A , 84 :3359 , 1987
Abstract :
PubMedSearch : Oakeshott_1987_Proc.Natl.Acad.Sci.U.S.A_84_3359
PubMedID: 3106966
Gene_locus related to this paper: drome-este6