myctu-Rv3084

 
Mycobacterium tuberculosis, Mycobacterium bovis, Rv3084 Probable lipase lipR, MTV013.05 Orf 05 of MTV013

Comment
There are more than 1000 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Block H
Mycobacterium tuberculosis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium tuberculosis complex: N E > Mycobacterium tuberculosis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic


Inhibitor: Lalistat-1 , Lalistat-2 ,
>3 Genbank links 1 more: AL021309, BX248344, CP003248
3 UniProt : P9WK84, P9WK85, A5U799
1 Ncbi-nid : 3261510
1 Ncbi-pid : 2808431
3 UniProtTrembl : P9WK85, P9WK84, A5U799
3 Interpro : P9WK85, P9WK84, A5U799
3 Prodom : P9WK85, P9WK84, A5U799
3 Pfam : P9WK85, P9WK84, A5U799
3 PIRSF : P9WK85, P9WK84, A5U799
3 SUPERFAM : P9WK85, P9WK84, A5U799
3 QuickSwissBlast : P9WK85, P9WK84, A5U799
 
Sequence
Graphical view for this peptide sequence: myctu-Rv3084
Colored MSA for Hormone-sensitive_lipase_like (raw)
MNLRKNVIRSVLRGARPLFASRRLGIAGRRVLLATLTAGARAPKGTRFQR
VSIAGVPVQRVQPPHAATSGTLIYLHGGAYALGSARGYRGLAAQLAAAAG
MTALVPDYTRAPHAHYPVALEEMAAVYTRLLDDGLDPKTTVIAGDSAGGG
LTLALAMALRDRGIQAPAALGLICPWADLAVDIEATRPALRDPLILPSMC
TEWAPRYVGSSDPRLPGISPVYGDMSGLPPIVMQTAGDDPICVDADKIET
ACAASKTSIEHRRFAGMWHDFHLQVSLLPEARDAIADLGARLRGHLHQSQ
GQPRGVVK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNLRKNVIRSVLRGARPLFASRRLGIAGRRVLLATLTAGARAPKGTRFQR
VSIAGVPVQRVQPPHAATSGTLIYLHGGAYALGSARGYRGLAAQLAAAAG
MTALVPDYTRAPHAHYPVALEEMAAVYTRLLDDGLDPKTTVIAGDSAGGG
LTLALAMALRDRGIQAPAALGLICPWADLAVDIEATRPALRDPLILPSMC
TEWAPRYVGSSDPRLPGISPVYGDMSGLPPIVMQTAGDDPICVDADKIET
ACAASKTSIEHRRFAGMWHDFHLQVSLLPEARDAIADLGARLRGHLHQSQ
GQPRGVVK

no DNA




References
7 more
    Title: [Mycobacterium Tuberculosis Rv3084 Encodes Functional Esterase and Suppresses the Pro-inflammatory Cytokines in vivo]
    Zhang CX, Luo T, Ma PJ, Wang CH, Suo J, Zhai XQ, Peng X, Bao L
    Ref: Sichuan Da Xue Xue Bao Yi Xue Ban, 50:291, 2019 : PubMed

            

    Title: The alpha/beta Hydrolase Fold Proteins of Mycobacterium tuberculosis, With Reference to their Contribution to Virulence
    Johnson G
    Ref: Curr Protein Pept Sci, 18:190, 2016 : PubMed

            

    Title: Human lysosomal acid lipase inhibitor lalistat impairs Mycobacterium tuberculosis growth by targeting bacterial hydrolases
    Davda D, Martin BR
    Ref: Medchemcomm, 7:1797, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer